SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004204 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004204
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily EF-hand 8.95e-31
Family Calmodulin-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004204   Gene: ENSXMAG00000004197   Transcript: ENSXMAT00000004209
Sequence length 187
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH559358.1:960:10499:1 gene:ENSXMAG00000004197 transcript:ENSXMAT00000004209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNKQTTFTEEQLEAYQDCTHFTRKEILSLHGRYRELAPHLVPLDYTNNPDIKVPMALIV
TMPELKENPFRDRIVETFSEDGQGNMSFNDFVDMFSALCETSPRELKTIYAFKIYDFNRD
NFICKEDLQKTLNKLTKGELTPEEVRLVCDKAIEEADLDADNKLSFADFENMISKAPDFL
SNFHVRI
Download sequence
Identical sequences M3ZPR1
XP_005816887.1.87360 ENSXMAP00000004204 ENSXMAP00000004204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]