SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004575 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004575
Domain Number 1 Region: 292-409
Classification Level Classification E-value
Superfamily EF-hand 1.46e-30
Family Osteonectin 0.0084
Further Details:      
 
Domain Number 2 Region: 200-273
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.23e-21
Family Thyroglobulin type-1 domain 0.0013
Further Details:      
 
Domain Number 3 Region: 50-146
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.57e-17
Family Thyroglobulin type-1 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004575   Gene: ENSXMAG00000004572   Transcript: ENSXMAT00000004580
Sequence length 438
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556815.1:26846:55667:-1 gene:ENSXMAG00000004572 transcript:ENSXMAT00000004580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVWPLLALLCLMCAGRAQKFSALTFLRVDQDKECNMECTGAPRKPLCASDGRTFTSRCE
YLRAKCRDPQLEVSRGPCKETSRCVAEKKYTEQQAKKQAFVPVCNPDGTYSEVQCHSYTG
YCWCVTPNGRPISGSSVVNKKPRCQGSKQDRAAPVEPRPEEPTVIFCCVDRPTQKEEDVT
SPYPDLWSVHLNSNRQNRSRASPSSCDQEQQSALEERRQRNNDAVFVPDCAQGGFYKPVQ
CHPSTGYCWCVLVDTGRPIPGTSTRYEQPKCDGNARAHPTKPKDHYKSRHLQGCPGAKKT
EFLTSVLDALSTDMVHAVTDPASAGRMAEPDPSHTLEERVVHWYFSQLDKNGSGDIGKKE
IKPFKRFLRKKSKPKKCVKKFVEYCDISNDKALSLQELMGCLGVTKEDGKLKTCFCLTGA
KSGEDLPSSKLNPVRKQG
Download sequence
Identical sequences M3ZQT2
ENSXMAP00000004575 ENSXMAP00000004575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]