SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004642 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004642
Domain Number 1 Region: 37-154
Classification Level Classification E-value
Superfamily Hormone receptor domain 7.59e-26
Family Hormone receptor domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000004642
Domain Number - Region: 126-409
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00192
Family Rhodopsin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004642   Gene: ENSXMAG00000004623   Transcript: ENSXMAT00000004647
Sequence length 438
Comment pep:novel scaffold:Xipmac4.4.2:JH556859.1:484207:500050:-1 gene:ENSXMAG00000004623 transcript:ENSXMAT00000004647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDMWMSLTLSLVAALALGTEVSAAHYEADFSNDDLSSLYGNSRHQILLAQYECYLKMIHE
PLHTDEGPFCNRTWDGWMCWDDSAPGTSMQMCPSYFIDFDARAETATKICNPDGQWFHHP
ASKRVWTNYTLCSAYSKDKLKFTLSLYYLAMAGHGISIISLIISLIIFSYLKSLSCQRIS
LHKNMFISFIFNSVFTMGWLSMISGGRQTINAINPVSCKILATLVAYTSTSNYFWMLCEG
IYLHTLIIVAVFVGEQQLVWYYVLGWVFPIFPALIYAFARGFYFNDTCWISSNSHLLYII
HGPIHAALFVNFFFLLNVIRVLITKLRKTHCAESTTYMKAVRATLILIPLLGVQYILMPW
TPHEFDNQVIYCFVAILSNFQGLLVSIILCFCNAEAQTALRRKWVQWKIAWGKTGLGETQ
FVSHHFSCHTTSSIVETS
Download sequence
Identical sequences M3ZQZ9
ENSXMAP00000004642 ENSXMAP00000004642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]