SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004836 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004836
Domain Number 1 Region: 22-253
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000504
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004836   Gene: ENSXMAG00000004828   Transcript: ENSXMAT00000004841
Sequence length 259
Comment pep:novel scaffold:Xipmac4.4.2:JH556815.1:502700:507469:-1 gene:ENSXMAG00000004828 transcript:ENSXMAT00000004841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFEVYLNVMIWMDVRVCFPFTLLAIGLCRMVHFDNLPPIYYTNLLTANAVQLITLIATV
GTKNGRFPNAACLIIYGGVAMVSLYLRMIIALERCFFIIQLPFIRQTKYSLIICVSVWVF
CMGLFPLLVIFHYFSVIFVFALIPSIISLLCPLGAFISLPRAASGSPEGKRRIIATFVLL
LINYSVTIVPPVSFLTFRSDYYYMYEDTQFFMTLFLLSPFMDLLLFVFLREGPVDQLLAC
FCCCKMETPAVEDGSRLSI
Download sequence
Identical sequences M3ZRJ3
ENSXMAP00000004836 ENSXMAP00000004836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]