SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004858 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004858
Domain Number 1 Region: 3201-3464
Classification Level Classification E-value
Superfamily YWTD domain 6.15e-51
Family YWTD domain 0.0000023
Further Details:      
 
Domain Number 2 Region: 1436-1698
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-50
Family YWTD domain 0.000003
Further Details:      
 
Domain Number 3 Region: 2392-2647
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-44
Family YWTD domain 0.00000391
Further Details:      
 
Domain Number 4 Region: 387-650
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-43
Family YWTD domain 0.00000719
Further Details:      
 
Domain Number 5 Region: 4057-4327
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-42
Family YWTD domain 0.0000127
Further Details:      
 
Domain Number 6 Region: 1745-2001
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-41
Family YWTD domain 0.0000592
Further Details:      
 
Domain Number 7 Region: 706-961
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-41
Family YWTD domain 0.0000224
Further Details:      
 
Domain Number 8 Region: 2063-2335
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-37
Family YWTD domain 0.0000254
Further Details:      
 
Domain Number 9 Region: 258-274,309-378,643-698
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.43e-17
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 10 Region: 1098-1137
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000458
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 11 Region: 2019-2058,2344-2385,2646-2709
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000157
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 12 Region: 1259-1300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 13 Region: 3627-3667
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000367
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 14 Region: 2859-2897
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000471
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 15 Region: 2736-2778
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 16 Region: 1057-1096
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000654
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 17 Region: 2987-3030
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000109
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 18 Region: 98-138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000122
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 19 Region: 3071-3111
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000126
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 2700-2738
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000013
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 21 Region: 2903-2941
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 22 Region: 3146-3194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000293
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 23 Region: 1015-1053
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 24 Region: 212-252
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 25 Region: 3028-3070
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000929
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 26 Region: 1140-1177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000956
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 27 Region: 3511-3547
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 28 Region: 18-59
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000102
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 29 Region: 3798-3835
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 30 Region: 3548-3589
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 31 Region: 177-215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 32 Region: 3719-3756
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 33 Region: 3586-3631
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 34 Region: 1178-1217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 35 Region: 3112-3159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000796
Family EGF-type module 0.026
Further Details:      
 
Domain Number 36 Region: 3928-3964
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 37 Region: 1348-1429,1690-1739
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000942
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 38 Region: 3841-3877
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 39 Region: 2815-2861
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 40 Region: 3754-3794
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 41 Region: 1222-1259
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 42 Region: 62-99
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 43 Region: 143-176
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 44 Region: 2945-2988
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 45 Region: 1304-1340
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000838
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 46 Region: 3682-3715
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000877
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 47 Region: 3884-3921
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000126
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 48 Region: 2781-2820
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000537
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 49 Region: 4008-4040
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000762
Family EGF-type module 0.011
Further Details:      
 
Domain Number 50 Region: 3970-4009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000762
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000004858
Domain Number - Region: 973-1019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000302
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 4338-4370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00724
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004858   Gene: ENSXMAG00000004744   Transcript: ENSXMAT00000004863
Sequence length 4412
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556696.1:2037392:2090850:-1 gene:ENSXMAG00000004744 transcript:ENSXMAT00000004863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRAPPLQLFFFFLCSVRWCHAEGCELGQFRCGTGRCIPEEWHCDGTSDCIDDTDEHDCS
QVTCDDSHFQCLSDGECIPDVWVCDNEEDCEDSSDERHCPGRTCTSGQFSCSNGACIPGE
YHCDHLADCLDGSDERNCNYPQCTEMRCANGACYNRTQRCDHLLDCRDGSDEANCTQHCN
TGFYQCHNGLCVPQRYVCDHDDDCGDRSDEINCTYPACRGNYFTCPSGRCIHQVWLCDGE
DDCEDNADEKGCDNVPRECYPGEWPCPSSGLCIPMDKLCDGKADCPDGEDETNTTAGHNC
SIWKCASLSCEHHCHTSPDGGTCACPSGYIVNSNDSRSCIDFDDCSMWGNCDQLCEDRIG
SHRCSCREGYTLEQHRYCRADISTGVPSLVFSNGRDLVIGDIHGNNLRTLVNSQNRGIAV
GVDFHYHLRRVFWTDTIQNKVFSVQMDGSNMQVVLNVSVDYPENLAVDWVNNKLYVVEAS
VNRIDMVDLDGSNRVTLITENLGNPRGLAVDPTVGYMFFSDWEAANGQPGLERAFMDGTN
RYGIIGSKLGWPAGITLDIEVKRIYWVDSRYDYIETATYDGLHRKTVIHGGTVVPHPFGI
SLFEHNVYFTDWTRMAVIKANKFTDSNPHVIYTTSHTPHGVAVIHQLKQPQAPNPCSLDR
GGCEQICVLSHRSDNGGLGYRCKCRIGYDLHADGKRCLAVRQFLLFSSQLAVRGIPFNLS
SQEDIILPVTGSPSYFVGVDFSAEDDAIFFSDTAKDIIYKQKVDGTDREILAANRVEGVE
DLAYDWISKNLYWTDPRYRSISVMRLADKSRRAIIQNLNNPRAIVVHPLIGYIFWTDWYR
PAKIMRAWGDGSHAMSIVNTTLGWPNGLAIDWSSMRLYWVDAFFDKIEHSNFNGQNRLSL
DRITQISHPFGLTIFEGFAYFTDWRLGGIVRVRKTDGGQMVVIRRGISHIMHVKSFNSNS
QIGANLCNRQTNPNGDCSHFCFPAPDSQRVCGCPYGMKLLPNQQTCVEDPSNEPPTMQCG
ANSFSCGNGKCVPNTYRCDGVDDCHDNTDELHCGINNITCSPLAFTCASQRCLPAGWRCD
GHNDCFDNSDEINCPTRVPGTCPANQFTCANHRCIPHTWRCDTDNDCGDGSDEADCYLGS
TCHPGQFQCPDHRCIDPNYVCDGDRDCVDGADEQGCIYNCTVSEFKCTSGHQCINSYYRC
DGVFDCSDRSDEQNCPTRPPGMCHHENEFQCQSDGSCIPSSWECDGHPDCQDGSDEHHAC
PPRTCPSSLFRCDNGNCIVRSWICDGDNDCRDMSDERDCPTPPFRCPSWQWQCPGHSVCI
NLTTVCDNTPNCPNGADESPLCNEPLPDQESCSDNNAGCTHGCIQGPFGAQCTCPVGYQL
SNDSQTCEDIDECNPPGLCSQHCFNERGSFRCHCQDGYTLEADQRTCKASDSRQAFLLVA
SRNQIIQDEISAQPNVIRSLIRDGRNVVAIDFDSVSARVYWSDTTQDRIWSSHINGSERT
VIFDSGVTVTESLAVDWVGRNLYWTDYVLETIEVSKLDGTHRTVLVSENVTNPRGLVVDP
RDSAHLMFWTDWGRNPRIERASMDGKLRTVIISSKLYWPNGLTIDYPNNLLYFADAYLDF
IDYCDYNGNNRKQVLASDLVLQHPHAITIFEDFVYWTDRYINRVMRAHKWHGENQTVMLF
NLPQPMGLVAVHPTRQPSGRNHCLGSACTHICLLSAVGPRYYSCACPSGRTLAADQFTCA
RVEDPFLVVVRDSIIYGIPLNPEDKSNDAMVPVAGLHNGYDVDFDDKEQTIYWVEHPGEI
HRVKSDGTNRTEFAPAAILGSPVGLALDWITENLYYTNPATQSIEVLKLRGDVQYRKTII
TNNGSPTGAGSPVGIAVDPARGKLYWTDQGTESGIPAKVAAADMDGMNPVTLFTNNLDHI
EFLTVDIQENKLYWAVTGTGKIERGDPDGSNRITLVTGLSHPWGVAVYQNYLFFSDRDFE
VIERVDKSTGANRVVMRDNLSGLRVLKVHFRDTSAGTSNGCTNNMGACEQLCLPRPQGFF
TCACATGFKLNADNRTCAHYKSYVVISTLSAIKGFSLEGSDHSEAMVPVAGRGRNALHVD
VHMASGFIYWCDFSSTVMIQNGVRRIKPDGSGLHSVVTSGIGRNGIRGIAVDWAAGNLYF
TNAFLTETYVEVLRLNTTFRKVLLKTQVDMPRHLVVDPRNRYLYWADYGQHPKIERALLD
GTNRTILVSSGIITPRGLALDWHTGYVYWVDDSLDMIARIGPHGGETEIVRYGSRYPTPY
GITVFENSIIWVDRNLKKVFQASKEPGRTEQPAVIRDNINMLRDVTIFDQRTQPTSVQEL
NYNPCMENNGGCGHFCFALPGSSQGTQNKKCSCAFGDLATDKESCEMSKEDYLIYTTEST
VRSLRLDPEDHALPFPVVNVPRTSIALDFDLTDNRIYFTQSSGAGASKISYISLSSPTTA
PVVVAADLGAPDGIAYDWINKRIYYSDYVNQSISSMSVDGAQKTIIAHVSRPRAIMLDPC
RGYMYWTDWGTHAKIERATLGGNFRTDIVNSSLVWPNGLTLDYEEERLYWADASLQKIER
SSLSGANREVIVSTAIYPFAMTMFGQFIYWTDWNTRSIYRANKHDGSDQRVMIQNLPSRP
MDIQVLARRKQQRCDSPCQQFNGGCSHICTPGPNGAECQCPAEGRWYLADSKYCIPDNGT
RCQPGQFTCMNGRCIRPQWICDNDNDCGDGSDELERVCAFHTCEPTVLTCGNGRCVPYHY
RCDHYDDCGDNSDEVGCLFRPCDPSTEFACNNGRCIAKDYVCNGINNCYDNGTTDEQNCT
ERTCQPEETKCQSTNICIPRSYLCDGDNDCGDMSDESPTHCAAATCSQSEFRCSSGRCIP
AHWYCDGGADCSDGSDEPLSCTTLVRTCNTDQFRCDDGRCIALSWICDGDNDCGDMSDED
QRHNCANRTCSSTEFTCVNNQPPQRKCIPRDWVCDGDADCADALDEHQNCTRRSCGINEF
TCSNGLCIRSSYRCDRRNDCGDSSDEQGCTYHPCQSHQFTCQNGRCVSNDFVCDGDNDCG
DESDELQHMCHTPEPTCPPGEFRCENGHCIPFRKVCDRNDDCSDNSDEKGCGINECTDPS
IHHCDHNCTDTPTSFICTCRPGYRLMSDGKTCDDVNECAETPSVCSQICENTVGSYVCKC
SPGFLREPDGRSCRQNSNISPYLIFSNRYYLRNLSTDGQAYSLILQGLTSVVALDFDRVD
KRLYWIDVSRRVIERMSFNGSNREVVVNGVLHGEGLAVDWIGRKLYWVDSFLDCLKVSEL
DGRFVKKLAEHCVDGNNTYCFENPRGIVLHPKYGYVYWTDWGNKAFIGRVGMDGTNKAAI
ITTKIEWPNGITIDYTNDKLYWSDAHLNYIEYSDLDGQHRHTVYDGNLPHPFALTVFEDT
VYWTDWNTRTVEKGNKYDGSGREALVNTTHRPFDIHVCHPYRQPIVNNPCAANNGGCSHL
CLIRHGGREHTCDCPDHFLAVQIGGVTRCLPMCTSTQYRCANNERCIPIWWKCDGQRDCR
DGSDEPSTCPIRHCSLGQFQCNDGNCTSSHFLCNSHRDCPDGSDEDAVLCATHQCESHQW
QCTNKRCISESWQCDSEDDCGDQSDEDPVHCATRTCRPGQFKCRNGRCIPQSWKCDVDDD
CGDNSDEPLEECMGPAYRCDNHTEFACKTNYRCVPLWSICNGHNDCRDNSDEQSCEEVTC
DPTGDFRCDNHRCIPLRWRCDGADDCGDNSDERSCTPRSCTESEYRCDNLRCVPNRWVCD
HDNDCEDNSDERDCELRTCPPGYFQCTSGHCIAERFKCDGNADCLDYTDETSCPTRFPNG
TYCPPFLFECRNHICVQPHWKCDGDNDCGDNSDEELHLCLDIECEAPFRFRCDNNRCIYS
PELCNSIDDCGDGSDERQENCQKPTHGPCDDEEFKCSTGKCIPLQYACDEYDDCGDESDE
LGCHVGHGHTCSANMCEHNCTDLTQGGFVCSCRPGYKPRATEKHTCEDVNECEVFGTCPQ
DCRNSKGSYECFCAEGFVSFGELHGTECAAQGNPPVLLLPDNIRIRRFNLSSEQYSDYVD
NAEHIHALDYLWDPEGEGLSVVYWTVLGRGSQFGSIKRAYMTTFNDYGSNPVKEVDLNLR
YIAKPEGIAVDWVGRHIYWTDSGTNRIEVAKLDGRYRKWLVHTDLHQPAAIIVNPSSGMM
YWTDWGQNPKIEAAWMDGQHREVLVKEEDLGWPTGLALDYVNGNRIYWCDSKENIIESMK
PDGTDRKIVISGDIGNPYSLDVFEGNVYWTTKDKGEVWKTNKFGQGNKVKVLTINPWLTQ
VRIYQQYRHNQSVSNPCKNVCSHLCLLRPGGYTCACPQGSPPLNADSTECDADVHMAILA
ATVRWGSLEVHQLVQVQQHNFHLTFNIMYAAV
Download sequence
Identical sequences M3ZRL5
ENSXMAP00000004858 ENSXMAP00000004858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]