SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004900 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004900
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-22
Family YWTD domain 0.00031
Further Details:      
 
Domain Number 2 Region: 351-387
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 255-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 4 Region: 216-257
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 5 Region: 313-346
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 181-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004900   Gene: ENSXMAG00000004891   Transcript: ENSXMAT00000004905
Sequence length 387
Comment pep:novel scaffold:Xipmac4.4.2:JH558460.1:11398:22077:-1 gene:ENSXMAG00000004891 transcript:ENSXMAT00000004905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLMFWTNWNEQRPSIMRSTLVGKNIRIIISSDILTPNGLTIDHKAEKLYFSDGSLGKIER
CDYDGSSRYVILKSGPGNFYGLAIYADFIYWSDWARRAVLRSNKYTGADTKVLRADIPHQ
PMGIIVVAKDTNNCELSPCRHMNGGCGDLCLLTAHGRVNCTCRGERVLLDDNRCVSENSS
CNIYTEFECGNGECIDYQLTCDGVAHCKDKSDEKMQYCDNRTCRRGFRSCYNQRCVASGR
FCDGIDDCGDNSDEAFCSNTTCGSSEMSCKDGSCVSISAWCNQVIDCADASDEKNCNHTD
CSHFYKLGVKEKDFISCNSTSLCIHPSWICDGANDCGDYADETNCLVSHGQKCEEGHFAC
PSGNCISSVWLCDGQKDCEDGADEFQC
Download sequence
Identical sequences M3ZRQ7
ENSXMAP00000004900 ENSXMAP00000004900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]