SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004959 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004959
Domain Number 1 Region: 167-306
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.11e-18
Family CRAL/TRIO domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004959   Gene: ENSXMAG00000004950   Transcript: ENSXMAT00000004964
Sequence length 354
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556689.1:1348257:1361616:1 gene:ENSXMAG00000004950 transcript:ENSXMAT00000004964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFELNKSACQLQGLPPPVYLLLSSVPLGMDLTTHSKMTSEGDDGRPVPPTSLPLQGGPS
QRKKLSAPQISFSLDHSEDDLGETPDDLDIDVDELDTPDEGDYLDYTDHEMDWEDPGAAT
KSGTGDSYNTIPTYSAEEERRDVKLWRTVVIGEQEHRINMKVIEPYMKVISHGGYYSSGV
NAIIVFAACFLPDSAREDYHDIMENLFLYVISTLELMVAEDYMIVYLNGATPHRRMPGLG
WLKKCYQMIDRRLRKNLKSFIIVHPSWFIRTVLAITKPFISAKFSSKIKYVSSLDELREL
IPMDSIQIPECIIKLDKELKEAAENSKINSFLQGTELTAASRPDRQDQAGASSS
Download sequence
Identical sequences M3ZRW6
ENSXMAP00000004959 ENSXMAP00000004959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]