SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004979 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004979
Domain Number 1 Region: 12-348
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.56e-62
Family Rhodopsin-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004979   Gene: ENSXMAG00000004972   Transcript: ENSXMAT00000004984
Sequence length 356
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH559031.1:21:5150:-1 gene:ENSXMAG00000004972 transcript:ENSXMAT00000004984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNMSSLAPPTSASPPPPLNVSQYPPLTDWEPPSFTRAAQFRVGATSVLFLFAACSNLA
LLASVWCGRGRRLSSHLRPLMLSLAVADLMMTFVVMPLDAAWNITVQWYGGEALCKLLCF
LKLFAMHAAAFILVVISLDRHYAILHPLDALSAHRRNRCMLLLAWSLSLLLASPQLFLFR
TIRLDAANFTQCASHGSFTHRWQETLYNMFHFVTLYVVPLLLLSCCYSRILLHINQQHLQ
HKAGESPLRRSGTDLIPKARMKTLKMTVVIVLSFVVCWTPYYLLGIWYWFQPDMLRVMPE
YVHHALFVFGNLNTCCDPVIYGFYTPSFRADLAAFCRWTRSHASPRSPEHLSARQG
Download sequence
Identical sequences M3ZRY6
ENSXMAP00000004979 ENSXMAP00000004979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]