SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005282 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005282
Domain Number 1 Region: 27-119
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.49e-28
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 106-204
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.62e-16
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005282   Gene: ENSXMAG00000005275   Transcript: ENSXMAT00000005288
Sequence length 215
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557017.1:47432:50791:-1 gene:ENSXMAG00000005275 transcript:ENSXMAT00000005288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDESSEDFEDDRNKLGEYEGGRNDIGERHGLGKALLPNGDIYQGSYENGKRHGNGTYRF
RNRARYVGDYVQNKKHGQGTFYYPDGSKYEGAWVEDQREGLGVYTYPNGDIYDGEWLQHL
RHGQGTYLYKDTGAKYKGTWENGNMNSAGEYIYANHRYEGNFVKNTPQGPGKYVFDIGCE
QYGEYLKPDQDLAEETISTDGGPKWSPEYITSLTS
Download sequence
Identical sequences M3ZST9
ENSXMAP00000005282 ENSXMAP00000005282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]