SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005770 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005770
Domain Number 1 Region: 4-176
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.02e-68
Family G proteins 0.0000000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005770   Gene: ENSXMAG00000005757   Transcript: ENSXMAT00000005776
Sequence length 203
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556828.1:773989:785058:-1 gene:ENSXMAG00000005757 transcript:ENSXMAT00000005776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ
IWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVG
NKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGATAG
GGEKPNVKLTPGTTVKPSPGGCC
Download sequence
Identical sequences M3ZU77
ENSXMAP00000005770 XP_005806623.1.87360 ENSXMAP00000005770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]