SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005844 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005844
Domain Number 1 Region: 290-346
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 9.02e-17
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.008
Further Details:      
 
Domain Number 2 Region: 9-114
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 9.68e-17
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 103-145
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000000017
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005844   Gene: ENSXMAG00000005832   Transcript: ENSXMAT00000005850
Sequence length 764
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556666.1:1877956:1916286:-1 gene:ENSXMAG00000005832 transcript:ENSXMAT00000005850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGGRFNFDDGGSYCGGWEEGKAHGYGICTGPKGQGEYCGSWAHGFELLGVYTWPSGNT
YQGTWAQGKRHGLGVENKGRWVYKGEWTHGFKGRYGVRESTGTSGKYEGTWNNGLQDGYG
TETYSDGGTFQGQWVGGMRHGYGVRQSVPYGMAAVIRSPLRTSINSLRSGSEHSNGTALL
DRTTGSSGSSPAVSRGGFVLTAHSEAELLKGKRKGGLFRRSILSGLKLRKSESRSSLASQ
RSKQSSFRSEAGMSTVSSAASDINSTISLGDADAELAVADDDVDATATETYCGEWKNDKR
TGFGVSRRSDGLQYEGEWLSNKRHGYGCTTFPDGTKEEGKYKQNILVSGKRKNLIPLRAS
KIREKVDRAVEGAQKAADIARQKAEIALSRTAHAQGKAEAAVGAAQKAHEESRMARVTAK
QFSPSFQHPGNGMEVQRPKRQVSSEVEGEGLSSSAGTAESPDLYTKSVGSDDPSNDAATP
DLSPPSSSPPHTPPPPARPSQRSKSARFHRQSAVDHGDRGKDGGEKGGERGHTEIQVLME
GGGEGGLKAEYPRANSWSEDSRRGVLSKGGGGISGRGGSRTNGHKHSSSNHKSREHSSSN
HRQARGDRWTESSSSATWTSGHRGTYGRGGRLLEQDEEKISNYEMEMKPLQPRDSTTHKP
HGHGEERHGHGEGRSHGAPRQRHKNREGRDGGKDSTHKGEKMDSRPLRRDLTLSPPLKSS
PIIPDRQDLSLTPSKGNSAYSSILVAMVILLNIGVAILFIHFFI
Download sequence
Identical sequences M3ZUF1
ENSXMAP00000005844 ENSXMAP00000005844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]