SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005872 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005872
Domain Number 1 Region: 47-158
Classification Level Classification E-value
Superfamily Hormone receptor domain 8.24e-29
Family Hormone receptor domain 0.0000334
Further Details:      
 
Domain Number 2 Region: 117-412
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000476
Family Rhodopsin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005872   Gene: ENSXMAG00000005843   Transcript: ENSXMAT00000005878
Sequence length 445
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556923.1:392131:438043:-1 gene:ENSXMAG00000005843 transcript:ENSXMAT00000005878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVNSTGLSARISAPTSNRSRQLTEKQSAFTMDASVYDIILGELEELNCSLIEHFQDTFY
ENASLALLSADGLYCNVTTDEIGTCWPRSSTGRIVERPCPAYINGVKYNTTRSAYRECLD
NGTWALKINYSNCEPILEEKRKYPMHYKIALIINYLGHCISVGALIVAFILFLCLRSIRC
LRNIIHWNLITTFILRNVMWFLLQLIDHNIHDKNEPWCRLSTTIYNYFVVTNFFWMFVEG
CYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIVAWAIGKLYYENEKCWFGKEPGKYMDY
IYQGPIILVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLF
FVNPGEDDISQIVFIYFNSFLQAFQGFFVSVFYCFLNGEVRSAVRKRWHRWQDNHALRVR
VARAMSIPTSPTRISFHSIKQTTAL
Download sequence
Identical sequences M3ZUH9
ENSXMAP00000005872 ENSXMAP00000005872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]