SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005928 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005928
Domain Number 1 Region: 267-499
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-43
Family YWTD domain 0.0000162
Further Details:      
 
Domain Number 2 Region: 1065-1192
Classification Level Classification E-value
Superfamily Fibronectin type III 1.23e-18
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 3 Region: 9-138
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000000000012
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.013
Further Details:      
 
Domain Number 4 Region: 921-961
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 875-911
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 6 Region: 664-700
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000563
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 7 Region: 831-867
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000117
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 581-620
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 9 Region: 702-741
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 10 Region: 977-1014
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 11 Region: 622-661
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000484
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 12 Region: 781-817
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 13 Region: 745-778
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000511
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 14 Region: 1020-1056
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000484
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005928   Gene: ENSXMAG00000005898   Transcript: ENSXMAT00000005934
Sequence length 1192
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556862.1:918815:977875:1 gene:ENSXMAG00000005898 transcript:ENSXMAT00000005934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSLCETPSCCLAAGSVGRNLANKPNVYISSSAGARWKEALAGPHFYTWGDHGGILMAII
QGGSTKHLKFSTNEGETWIEFKFSDKEVYVYQLLTEPGEKSTIFTIFGSYAEQRHSWLIL
QVNTSDVLGVPCSEADYKRWSPSDEHGNECLLGREVTFKRRAPHATCFNGEDFDRPVTIS
NCSCTRQDYECDYGFKLSEDLSLQVCVPDPEFLGDLYAPPVPCPIGTSYRRSKGYRKVPG
DSCSGGDVEARLDGEMLPCPVGESNEFILYAVRNSIHRYDLATGTDQPLPLVGLREAVAL
DFDYDRNCLYWADISLDTIQRLCLNGSTGQEVIVRKDLQNVEALTFDPISRLLYWVDAGA
QKIEVSNPDGDLRHTLLNSSVLEHPRALVLLPAESMMFWTDWGDRAAGVYRGYMDGSNVS
CIVAEGVRWPNGITADDRWLYWTEAFSDRIERADFTGGQRSILMEGLPHPYAIAVFKNDL
YWDDWSRMGIFKAPKAGSQNNELIVGRLTGVMDLKIFYKGKNKGHNACTYQPCSLLCLPQ
PSHKHTCVCPEGAPTLTIPNGELQCQCPPGYQLQNNTCTKTEHSCLPNQYRCTNGRCISS
IWKCDSDNDCGDMSDEQECPTTTCDPSNQFRCIASGSCIPLAFKCDHEDDCGDNSDEEHC
ESHQCGPGEFTCAQGICIREVWRCDGDNDCRDWSDEANCTGHHTCEPSSFQCHTGHCIPL
RWKCDGDDDCQDNSDEDPQYCEGTQCKGFLCSNDTCLPAKAHCNGNHDCPDGADELNCDP
LCTRYMEFVCKNRAQCLFQSLVCDGIKHCEDGSDEEAAYAGCATPSEFGKVCDAYTFQCA
NEVCVSLEWKCDGMDDCGDYSDEANCAHTPEVPGCSRYFQFECGNGRCIPTWWKCDGEND
CGDWSDEAQCTGGVTPHAVTFGPVTCAPNRFQCGSGACIINTWVCDGYADCPDGTDELGC
PTANSSMAPAPPLSPGRCTQHQFQCHHPPHCIQEWLRCDGHPHCEDSSDEANCPTWQSLL
CTNGTRCSDGELCVLDSERCDGYLDCSDHSDEENCTMDTLAYKVQNLQWTPDFSGAITLI
WSRPKNLPSNSCYFLVHYRLVGMQEWTNMDTHSNKTSYKLAVLKPDTTYQVKVLTQCLNK
LHKTNEAITIRTPEGFPDPPRNLQLTCDSNEDGTVKVSWSPPDNRHGLIREY
Download sequence
Identical sequences M3ZUN5
ENSXMAP00000005928 ENSXMAP00000005928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]