SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006339 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006339
Domain Number 1 Region: 172-251
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.62e-20
Family Thyroglobulin type-1 domain 0.00019
Further Details:      
 
Domain Number 2 Region: 32-110
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.02e-19
Family Growth factor receptor domain 0.0000696
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006339   Gene: ENSXMAG00000006325   Transcript: ENSXMAT00000006347
Sequence length 252
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556736.1:1005251:1008823:1 gene:ENSXMAG00000006325 transcript:ENSXMAT00000006347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLRHVAVAVAVCSLLVTVTLGSPVVGSEPIRCAPCTPERLSQCPAVAPGCAEVLREPG
CGCCLACALKAGELCGIYTAPCGSGLRCTPRPGDPRPLHSLTRGQAVCTESAAPAPTPEP
QTQDQGEPDAEMDNSAITGSSYLPGLPFDPRAVTEAQESMKAKLIAIRRKLVEQGPCHLE
LVTALDKITKSQEKQGEKFTKFYLPNCDKRGLYKPKQCESSLDGQKGRCWCVNTWNGKLL
SSSDLPADAECP
Download sequence
Identical sequences M3ZVU5
ENSXMAP00000006339 ENSXMAP00000006339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]