SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006345 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006345
Domain Number 1 Region: 197-278
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 7.19e-25
Family Thyroglobulin type-1 domain 0.00015
Further Details:      
 
Domain Number 2 Region: 26-108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.33e-22
Family Growth factor receptor domain 0.0000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006345   Gene: ENSXMAG00000006331   Transcript: ENSXMAT00000006353
Sequence length 281
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556736.1:1010710:1032607:-1 gene:ENSXMAG00000006331 transcript:ENSXMAT00000006353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLCALCLAVALAALARLTGSVGPVVRCEPCDARALQQCKPLPKDCAESLREPGCGCCM
TCALGEGQACGVYTARCGSGLTCKHQPGENRPLQALLEGRGVCTSATKKLISYLKPAQKQ
ENAGNQVDDGANVTVTVVPAEETVNCGHSPGSMNTRPPLHNTLIQKAENRKTQSYKVEPV
SGGVSKDMHNFSLESKRETEYGPCRREIDSIMNSLKINNVLNPRGFRLPNCDKKGFYKKK
QCRPSKGRNRGFCWCVDKYGQPLPGYDDKQGKTKCYHLESK
Download sequence
Identical sequences M3ZVV1
ENSXMAP00000006345 XP_005802363.1.87360 ENSXMAP00000006345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]