SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006515 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006515
Domain Number 1 Region: 282-538
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-40
Family YWTD domain 0.0000216
Further Details:      
 
Domain Number 2 Region: 155-191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000432
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 3 Region: 68-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 29-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 106-146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 195-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 7 Region: 235-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000678
Family EGF-type module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006515   Gene: ENSXMAG00000006502   Transcript: ENSXMAT00000006523
Sequence length 669
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556736.1:1609760:1637387:1 gene:ENSXMAG00000006502 transcript:ENSXMAT00000006523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHLGGSFLPISLLILLHIRGAASHSLPACNQQFEFTCSDGSCLSKLKLCDGHTDCADGS
DEHHCGHSRCGKEEFTCRTRRCISSKLFCNGVDDCGDGSDEDSCHNCTPGSFSCGPAEAC
LPRNKLCDGWTDCKDGRDEAQGLCGSVQASPQKSSACAASEFQCGDGACIRHAWRCDHSS
DCSDGSDEENCDISNQDECQDNNGGCSHFCLDQPIGFLCRCPDNMKLVEDSRCEEVDACL
ESDICDQLCVHRNGSLTCECQEGYHMDPLTQQCKAEGSEAQLVFSSSKGIQVKNLINKEH
SILVPHSPGHGPVAVLASTHNVYWTERGRGSIYRMSVAENATEAVLVLKVQSSVSGLAVD
WIHQLLYWTNIEAGSLNVALLDGSFQRQLITGLNKPSAVAVDPLQGFLFLAQCGRTPVIQ
RVTQDGRTKLPLVTSLIRQPVALSLDLPRRLLYWFDQGMRSISRIDLEGRHRKTVVESNG
YLDRLFGLAVFEGSLYWGDGATHSICRANKHNGKNLQVMMSNITLSGGLVIAHPALQPKG
VAACGRPGMVCQHECVINLMSERQQFSCDSRQIRSNKTQVPSISRSVPASTLSHPMFAGI
LSVIMLLSMLLVGMTWWWWREEFRPSRSFTLQNLSLKESQNPLIDQGPPVGPNTTLVKET
LSRLDLNLE
Download sequence
Identical sequences M3ZWC1
ENSXMAP00000006515 ENSXMAP00000006515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]