SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006576 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006576
Domain Number 1 Region: 9-130
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.11e-24
Family Hormone receptor domain 0.00028
Further Details:      
 
Domain Number 2 Region: 101-389
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000751
Family Rhodopsin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006576   Gene: ENSXMAG00000006533   Transcript: ENSXMAT00000006584
Sequence length 429
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556671.1:3265962:3287857:1 gene:ENSXMAG00000006533 transcript:ENSXMAT00000006584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AESRRSYFCLEFICCLSAGLVLPSCQLRVKFLSVQTFSQLEMDAQTKPGCRGTWDNIACW
DRAEFGETVTIPCPRALKLLFSRNGNISRNCTAAGWSEVFPNISSVCGLDTRQEKLVFYV
VVQTLYTLGHSLSLIALTTGTAILCLFRRLHCTRNYIHLNLFISFILRAVAVLVKDAILF
NRSSQCSNQPSLVGCKASLVFFHYFIMANFFWLLVEGLYLHTLLVVIFSENQHFIVYMFI
GWGIPTVFVSVWVMTRIYLEDTGCWERNDNPIPNWVINGPIVVSILVNFIQFINIIRILV
QKLRCPDIGGNDQSQYRRLAKSTLLLIPLFGIHYVVFIDESITEDYKIFFDLALGSFQGL
VVAILYCFLNSEVQGELKRKWRSMCLNCHLSRVRHFNNNFASRNGSEQTMQFQRSSRAQS
ILQSETTVL
Download sequence
Identical sequences M3ZWI2
ENSXMAP00000006576 ENSXMAP00000006576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]