SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006711 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006711
Domain Number 1 Region: 494-721
Classification Level Classification E-value
Superfamily GFP-like 2.72e-80
Family Domain G2 of nidogen-1 0.000000186
Further Details:      
 
Domain Number 2 Region: 1071-1326
Classification Level Classification E-value
Superfamily YWTD domain 1.02e-45
Family YWTD domain 0.00000000636
Further Details:      
 
Domain Number 3 Region: 964-1048
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.22e-24
Family Thyroglobulin type-1 domain 0.00044
Further Details:      
 
Domain Number 4 Region: 450-491,730-812
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.13e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 5 Region: 853-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000668
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000006711
Domain Number - Region: 816-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000266
Family EGF-like domain of nidogen-1 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006711   Gene: ENSXMAG00000006650   Transcript: ENSXMAT00000006719
Sequence length 1338
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556663.1:1563646:1581478:-1 gene:ENSXMAG00000006650 transcript:ENSXMAT00000006719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASETGTMSWVKPGWLLWASFVGFMASVQSVRREEFFAFGPNAGDQPLNSGNDQTHRLSLS
KPLFFYDGTFDSIFINTNGFVATAEPTSESTYLGKMPPKFGMIAALQGDLDTSDGLGRVF
FRQDSSPDVLRRAAEHINRAFPDDDEVSPTAAVVITWLDVAAHEPQTRGDGIEKKRNTFQ
LVLASLETASYAILLYARDGVQFLSTPIGDNDVIMHSGFSQGLVRGFLFSSQGQYYRNSM
DNETSVRELAEKTNSGMRGVWVYEIGTSPHFSNVAPGEVTDLPPEAPLPVLEHEGQQRYA
NIDPDAEQIDVLEILPLPYQPHQPQNPEVVVVDDPEINVDGGSAQKNNYNYITSYLCALP
MELTQSSKINPRESLDGVRVVCHNRPEIKLLIHSFICLQLCLSFRILKLKKHSNKIVLSV
YLSIKTAESQIYTSVGHLFYLYSSFSVFSYNLGTCANSRNKCSQFADCRDYTSGFCCHCR
HGYYGNGLQCVAEGKPQRMNGKVNGRVFVGNSQSPVEFSSKDLHSYVVVNDGRSYVAISD
IPDALGPSLMPLSAISGVIGWAFALEQPGFKNGFGLIGGEFTRQAEMTFLPGNEKLTIRQ
EFKGTDEQDHLVVTTTLNGQIPEVPPGTSIQSEPYTEIYQYSSNLITSSSTQNYKLIFPE
GTSEYRRFQWRQTISFQGCQHGEVSRDMKPTQLLSVDQVFALYDAPNQLLRLAMSNKIGD
VNGGEPEENPCFTGRHGCDTNAICRPSQGNEFTCQCASGFNGDGRTCYDIDECRENPQIC
GPNSICNNQPGTFRCECDEGYQFGIDGRTCIEVDQPVNHCEEGTHNCDIPERAQCNYNGG
SSYICTCLPGFAGDGRSCRDIDECQQSRCHQNALCTNTQGSFICQCRPGYSGDGFYCSSG
ESMICSICHCYTESPLVYICSIFIQVKELKGFIYSVLGNSFIEVILYFWQRGEFFRSALL
LLGGLISFILYSERTKTQCEDIRERLLGQTSFNPRGPRPVGQFIPECDENGDYQPVQCFG
STGQCWCVDRNGQEIPGTRTDDGSQPYCLPHGTVAPPVGPRPRPDVVLPPGTHLLFAQSG
RIDHIPLEAYNMKKQDAKAVLHLPGKAIIGVAYDCMEKMVYWTEISSPSISKASIDGGEP
TAVITSDLSSPEGIAVDHMGRTMFWTDSVADRIEVASLDGTQRRVLIDTDLVNPRAIVTD
PINGNLYWADWNREAPKIETSYMDGSNRRLLVQSELGLPNALTYDSQSSLLCWADAGTHK
MECMNPGRAQRSTVLEGLQYPFGITTFGKNLYYTDWQRDAVVEVDQYAGKESDEFQPQKR
TNIYGIATAYAQCLPGST
Download sequence
Identical sequences M3ZWW7
ENSXMAP00000006711 ENSXMAP00000006711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]