SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000007009 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000007009
Domain Number 1 Region: 152-373,417-467
Classification Level Classification E-value
Superfamily MFS general substrate transporter 9.42e-51
Family LacY-like proton/sugar symporter 0.045
Further Details:      
 
Domain Number 2 Region: 583-724
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.88e-18
Family Glycerol-3-phosphate transporter 0.027
Further Details:      
 
Domain Number 3 Region: 490-560
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000017
Family Pentapeptide repeats 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000007009   Gene: ENSXMAG00000006957   Transcript: ENSXMAT00000007017
Sequence length 734
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556767.1:440202:462667:-1 gene:ENSXMAG00000006957 transcript:ENSXMAT00000007017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDTYNNRTSLVKGAKDMVKEAKRHTAKKVNKVVDRAADEYSSHRNYTRFQDEEDEDEDF
YRNQKGHERESYRDNEEGSSDATEGHDDEDEIYEGEYQGIPSAGDKKHKEGQVALGQPMS
DATRDHSELEQEREADEEELAQQYELIMQECGHGSFQWQLFFVLGLALMSDGVEVFVVGF
VLPSAETDMCVPNSSSGWLGSIVYLGMMVGAFFWGGMSDKVGRRQCLLICMSTNGFFAFL
SSFVQGYGLFLLCRVVAGFGIGGAVPIVFSFFAEVLSREKRGEHLSWLCMFWMIGEIYAS
AMAWAIIPHYGWSFSMGSAYQFHSWRVFVVVCALPCVCAVVALTFMPESPRYYLEVGKHD
EGWMILKQIHDTNMRARGQPEKVFTVNRIKIPRQLDELVEMESETGNPVSKFFFRTKAEI
HGIYLNLMKCFKYPMQENMMRLAIVWFTLSFGYYGLSVWFPDVIKHLQADEYASKVQFHN
NERIEGFTFNFTLENQIHRNGTFIHDQFVNMKLKSVTFIDSTFRYCTFDDVTSVGSLFKN
CTFIDTFFFNTDIDESKLVEGTEVINSTFTHNKTGCQMTFVDDYSAYWVYFINFLGTLAV
LPGNIVSALLMDKIGRLSMLGGSMILSGISCFFLWFGTSESMMIFMLCLYNGLSISAWNS
LDVVTTESFPTVRRGTGFGFCNALCKLAAVLGNLIFGSLVGITKAVPILMASSVLVGGGL
VGLRLPDTRSNVLM
Download sequence
Identical sequences M3ZXR5
XP_005804039.1.87360 ENSXMAP00000007009 ENSXMAP00000007009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]