SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000007063 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000007063
Domain Number 1 Region: 135-367
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.26e-52
Family Regulator of chromosome condensation RCC1 0.0052
Further Details:      
 
Domain Number 2 Region: 772-877
Classification Level Classification E-value
Superfamily POZ domain 9.16e-21
Family BTB/POZ domain 0.0059
Further Details:      
 
Domain Number 3 Region: 36-127
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.29e-16
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 4 Region: 534-638
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000596
Family BTB/POZ domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000007063
Domain Number - Region: 311-461
Classification Level Classification E-value
Superfamily YWTD domain 0.00288
Family YWTD domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000007063   Gene: ENSXMAG00000007032   Transcript: ENSXMAT00000007071
Sequence length 1347
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556935.1:280793:305834:1 gene:ENSXMAG00000007032 transcript:ENSXMAT00000007071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLALLDCTPKCRSQQHADQVVAALTSGSEGKLRAFLASHCHNATSLRDAFGRTALHLAA
SVGKKALLEWLLDAKGADLMLKDKESGWNALHRSAFYGHIHCLISLVKHGGPLSTLDKEG
LSVLDLTMKDRPAHVVFKNTNPSEVYMWGSNTNFSLGHGNQDSRHHPELVDVFARTGVYI
KQVVVCKFHSVFLSQKGQVFTCGHGQGGRLGHGDEQTYLVPRMVEGLMSHHCSQVAAAKD
HTVVLTEEGYVYTFGLNTFHQLGLTPPPASAHAPKQVFSKMLKGRAVIGVAAGRFHTVLW
TREAVYTVGLNGGQLGYLLDPNGEKCVTTPRQVSALHHKDVGIAMAAASDGATVVVTGKG
DVYLLADYQCKKMASKQLNIKKVLISGGSLDHRVHPQILNDSGGEKIAILALDEAGRVFC
WRSSGSAVRQCRWAYPRQVFMSDIALSNNGMMFVTPDGEGFSGVWAGEYKKYGEKKEVSV
EVSGPSDAGTMYERIRLEKLPFVHRAVSITMDSKGRNFGVLQADPRTSLFEVPSISPSSF
AQHFRSLLEEADETDSIHDVTLQAGERNFPAHKYILSMRSEFFRKLFMSERCGVNEELDK
EVRRGEDAVGCDLFILEKIAADMLEYALHFIYTDSCELLVPGARPRGSVMSTGQNQDSEH
ERLISSLQDLGLRGCSALEVYQSLSPSTKGDGNKAKNKGSKSSKKGKGGKGDKTRASEGG
ANPVKTLQAVAKNLGLGSLSARLDGVKYENGKINVVQKKTGSKPKFFQKKCSYLCDVTLK
SDDGKEFPCHKSVLCARLEYFNSMLGNPWIEATSCSALEMPTSSEILQVILEYIYTDESP
TIKDSPNVEFVCNVLVVADQLLITRLKEMCEVIITENLTLKNAAVLLEFATMYNAEQLKL
SCLQFIVLNIGALLESKALDILSEEVLVELSAAYRRAIPAMQRRVITPYPGAPDLSGYEE
EDLDSAFSPRPEGELDQTCREVLWKKAKVRAKKKPRRRSDSSGGYTLSEIIQSPPAAAVS
PVLVKTGKANSTESLQEVLTSDSEGSYMAVGSPRDMQSPVFHDKPEDERGFSQRLKTPPS
TPTSLRFSLPVLPPTPPTSIPKDLPKLIACPAHAPPVLDLRTIMDMEASSLQTLGATPKS
PGVVTSSVKHPTVSSKLSQKQRKMLAMASREAIVDSPPSKSVPIATPSKSSEKAWATAVQ
SPPPSCSFRALVEEEENRSARVGHTGPQRVQNALGTSASATPAARRVTFKNNESGEPEKP
TGPWVLGAVGSPPLSSLVTFASIVEEEKQQEAALIRSREKPLALIQIEERAIQDLLLHYK
ARDNPDELIAVETTSRGPMAAPTWHKH
Download sequence
Identical sequences M3ZXW9
XP_005809710.1.87360 ENSXMAP00000007063 ENSXMAP00000007063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]