SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000007158 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000007158
Domain Number 1 Region: 50-148
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.96e-29
Family Hormone receptor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 125-421
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000549
Family Rhodopsin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000007158   Gene: ENSXMAG00000007125   Transcript: ENSXMAT00000007166
Sequence length 478
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556684.1:735672:760513:1 gene:ENSXMAG00000007125 transcript:ENSXMAT00000007166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERKLDGFRWSWKVALILLCNLTTFLVRASMEVNESQQQHPNNVYHDFGITRNKIVTAQ
FECYQRIMKDNTNGRHEPMCNRTWDGWLCWDDTQPGVTSEQHCPDYFQDFDPSEMVTKIC
TNNGQWFVHPDSNRTWTNYTRCNEHTNEGMVTAMNHFYLTLIGHGLSLVSLFISLAIFFH
FKSLSCQRITLHKNLFFSFVLNSVITIIWLTAVANNRELVQRNPMSCKVSQFIHLYLFGC
NYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYLLGWGFPLIPASIHAIARSYYYNDNCWIS
SKTSLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESSLYMKAVRATLILVPLL
GIEFVLLPYKPEGRVSSEIYDYIMHILMHYQGLLVATIFCFFNGEVQAVLRRHWNQHHIQ
FGSSIGNHSDALRSASYTASSIIEVQGCYSIDGHTEHMNGKSFHDTDVSVLKSDSTFA
Download sequence
Identical sequences M3ZY64
ENSXMAP00000007158 ENSXMAP00000007158 XP_005798205.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]