SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000007490 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000007490
Domain Number 1 Region: 25-145
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.03e-17
Family Thyroglobulin type-1 domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000007490   Gene: ENSXMAG00000007455   Transcript: ENSXMAT00000007498
Sequence length 311
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556663.1:4423029:4425800:-1 gene:ENSXMAG00000007455 transcript:ENSXMAT00000007498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFILLALAVFAALQTVESACSTCRTMKWVNCEGAAPPCTCQITLDDSNRPAIDCEKLV
SKCFLMKAEMYRRKMGQDVRTNIGGKPHEDAIMDNDGIYNPDCENDGKFKAKQCNNTEEC
WCVNSAGVRRTDKGDKNMNCSKLVETYMIRLELTHKELESNNKVNVQALENSVKNLLQTR
YQVDGSLVKNVQYDPDGRYIVIDIEKEKGDRTTNLGNMAYYMEKDLKVSPLFNNQTKVQL
NGGSQKLDLNKIVVYYVDEERPTITMQYLTGGIIAVIVVVVLVVVLGLLALFFVNRKRQQ
RYSKTQQREQS
Download sequence
Identical sequences M3ZZ46
ENSXMAP00000007490 ENSXMAP00000007490 XP_005795218.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]