SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000007554 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000007554
Domain Number 1 Region: 1084-1423
Classification Level Classification E-value
Superfamily NHL repeat 5.23e-24
Family NHL repeat 0.0039
Further Details:      
 
Domain Number 2 Region: 778-855
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000412
Family Pre-dockerin domain 0.073
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000007554
Domain Number - Region: 1390-1412,1439-1580
Classification Level Classification E-value
Superfamily YWTD domain 0.000149
Family YWTD domain 0.045
Further Details:      
 
Domain Number - Region: 617-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000474
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 487-512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 587-611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family EGF-type module 0.079
Further Details:      
 
Domain Number - Region: 520-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00474
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 453-480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 654-688
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0145
Family EGF-type module 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000007554   Gene: ENSXMAG00000007490   Transcript: ENSXMAT00000007562
Sequence length 2624
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556673.1:2500543:2613135:1 gene:ENSXMAG00000007490 transcript:ENSXMAT00000007562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFSCFIYFLFFFPGSLFSDGAFQNHSRLRTPPLPLSHSHSPNHQHHAASINSLNRSNY
TPRSNASPAPTDSSAPPEGPASGQDSSSVQDNWLLNSNIPLETRNIAKQAFLETLQDNLI
EMDILASARHDASYNDGHFLFKPGGTSPMYCTTSPGYPLTSSTVYSPPPRPLPRNTFSRP
AFSLKKPYKHCNWKCAALSAILISVTLLLLLAYFVAIHLLGLNWHLQPMQRQMYQLSEDN
TSGLPFPTDLSLPPLGNTGLEIPDHRGKDTAESKLDSLFPDDSYIDMGEIDVGRKVAQQI
PPGIFWRSQVFIDHPMYLKFNVSLSKDALVGIYGRRGLPPSHTQFDFVELLDGRRLLAQD
AHSLEGPAALQRSLVPITTHDTGFIQYMDSGIWHLAVYNDGKETETVSFLTTAIDSIDDC
PSNCFGNGDCVSGTCHCFLGFKGPDCGRAACPVLCSGNGQYLKGRCMCHSGWKGSECDVP
TSQCIDITCSGHGTCIGGTCICNPGYKGENCEEVDCLDPTCSGRGVCVQGECHCFIGWGG
PGCESPRASCMDQCSGHGAFLADTGTCSCDPNWTGHDCSTEICAADCGGHGVCVSGTCRC
DDGWMGAGCDQRACHPRCNEHGTCKDGKCECSPGWNGEHCTIAHYLDKVVKEGCPGLCNG
NGRCTLGNNGWYCVCQLGWRGTGCDTSMETACSDVKDNDGDGLVDCMDPDCCLQATCHTT
SLCVGSPDPLDIIQETQMSSAQSNLQTFYDRVSFLVGRDSTHTIPGANPFDGNHACVIRG
QVVTSDGTPLVGVNVSFINNPAFGYTITRQDGSFDLVTNGGIAIALHFERAPFITQEHTL
WLPWGRFFVMDTIVMRHEENDIPSCDLSSFSRPIPVVSPAPLTAFAGSCSERGTVVPEIQ
SLQEEVRIPGTEMKLSYLSSRTPGYKSILRVTLTHSTIPFNLMKVHLMVAVEGRLFRKWF
PAAPNLSYDFVWDKTDVYSQKVYGLSETFVVSVGFEYESCPDLILWEKRTAVLQGYETTA
SKLGGWTVDKHHALNIQSGILHMGNGENVFISQQPPVIGSMMGNGRRRSISCPSCNGLAD
GNKLLAPVALACGSDGSLYVGDFNYVRRIFTTGNVTSVLELRNKDFRHSNSPAQKYYLAS
SPVNGAVYLSDTGSRKVFRVKSLTVVNNVAKNLELVAGTGDQCLPYDDARCGDGGKAVEA
TLTNPRGITVDKYGVIFFVDGTMIRRIDQNGIISTLLGYNDLTSARPLSCDAVMDISQVR
LEWPTDLAVSPMDNSLYVLDNNVVLQVSENHQVRIVAGRPMHCQVPGIDHFLMSRVAIHA
TLESANALTVSHNGVLYIAESDEKKINRVRQVSTNGEISLVAGAPSGCDCKNDVNCDCYS
GDGGYAKDAKLNAPSSLAVCPDGELYIADLGNIRIRYVRKNKPFLNPLSMYEVSSPINDE
LYLFDSNGSHIFTQSLTTGDHLYNLTYTGKGDISGITDKNKNSVTIRRDTTGMPLWLMVP
DGQTFWFTIGTNNALKTVAAQGQELAVMTYHGSSGLLSSKTNENGWTTFFEYDGYGRLTN
ITYPTGRVSSYRTEADSSVRIQTEGSNREDITVTTNLSASGNFYTLLQEQVRNSYFIGLD
GSLRLVLANGMEVSLYTEPHLLAGTVNPTVSKRNITLAIDNGLNLVEWRQRKEQARGQVT
VYGRRLRVHNRNLLSLDFDRITRTEKVYDDHRKFTLRIHYDHAGRPTLWAPSSRLNGVNV
TYSSGGHVAGIQRGTMSVRMEYDVNGRITSQIFADGKYWSYTYLEKSMVLLLYSQRQYIF
EFDKNDRLSSITMPNVARHTLETSRSIGYYRNTYRPPEGNASVLQDYSEAGQLLQTTHLG
TGRRVIYKYGKLSKLLEILYDTTRIGFSYDEMAGMLKTVNLQSEGFTCTIRYRQIGPLID
RQIFRFSEEGMVNARFDYVYDNSFRVTSMQAVINETPLPIDLYRYDDVSGKTEQFGKFGV
IYYDINQIITTAVMTHTKHFDAYGRVKEVQYEIFRSLMYWMMVQYDNMGRVVAKELKVGP
YANTTRYTYEYDADGQLQVVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDIRDRI
TRLGDVTYRMDEDGFLKQRGNDYFEYNSAGLLTKVYNKANGWSIKYRYDGLGRRVSSRSS
TDHHLQFFYADLSSPTRVTHMYNHSSSEIASLYYDLQGHLFAMELSSGDEFYVACDNIGT
PLAVFSGSGLMIKQILHTAFGEVYLDTNPSFQIIIGYQGGLYEPLSKLVHMGKRDYDVLA
GRWTTPDREIWSHLNNNRIVPFNLYMFKNNNPLSNNEETKCYMTDVNSWLVTFGFQLYNV
IPGYRKPSTESMEPSYELVRTQIKTQEWDSTKSLLGVQCEVQRQLKAFVKLERFGQIYNA
KSAGCPQTEGKKIFASGGSIFGKGVKFAIRDGRISTDIISLANEDGRRMAAVLNDAFYLE
NLHFTIAGMDTHHFVKLGSVEGDLALIGMTVGRRTLENGVNVTVSQVNTVLNGRTRRITD
IQLQHGSLLLNTRYGGSVDEEKARVLELARQRAVGQAWARERQRLRDGEEGSRTWTEGEK
QQLLGSGKVQGYDGYYVVSVDQYPELADSVNNIHFMRQSEMGRR
Download sequence
Identical sequences M3ZZB0
ENSXMAP00000007554 ENSXMAP00000007554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]