SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000007572 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000007572
Domain Number 1 Region: 2038-2334,2371-2533
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.83e-78
Family Acetylcholinesterase-like 0.000034
Further Details:      
 
Domain Number 2 Region: 294-360
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 7.59e-16
Family Thyroglobulin type-1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 607-658
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000000118
Family Thyroglobulin type-1 domain 0.0012
Further Details:      
 
Domain Number 4 Region: 885-939
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000000157
Family Thyroglobulin type-1 domain 0.0018
Further Details:      
 
Domain Number 5 Region: 22-91
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000000000406
Family Thyroglobulin type-1 domain 0.0025
Further Details:      
 
Domain Number 6 Region: 110-166
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000183
Family Thyroglobulin type-1 domain 0.0029
Further Details:      
 
Domain Number 7 Region: 650-721
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000235
Family Thyroglobulin type-1 domain 0.0025
Further Details:      
 
Domain Number 8 Region: 952-1010
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000000837
Family Thyroglobulin type-1 domain 0.0059
Further Details:      
 
Domain Number 9 Region: 165-202,233-249
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000114
Family Thyroglobulin type-1 domain 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000007572
Domain Number - Region: 1263-1330
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00102
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 1335-1371
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0955
Family Thyroglobulin type-1 domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000007572   Gene: ENSXMAG00000007509   Transcript: ENSXMAT00000007580
Sequence length 2533
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557276.1:43099:63907:1 gene:ENSXMAG00000007509 transcript:ENSXMAT00000007580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLLCTVWILLCGAALLDGRASEYQLESEALSRCEILRSVAVGTKQEEVPHCLEDGSFR
SVQCGGRSQECWCVDSEGQEVTGTRTNNSIPHYSLQFCEFHKKTSCLVPGPTPCQLQSLL
RCAPSGLFEPVQCDSRGRCWCVDQDGMELYGTRQAGRPRRCPSSCEVRSRRLLHSSASSP
PQCAADGSFLPVQCKFINTTDRTELDLLLAFSSSPEAFDTFRNFRKFFPLVSSYCFCSDG
RGRELQGTGVELLMSEVYDSAFSGSRSARSFAQTNIYRVLQRRMLGVRLALTGHFRCPTP
CEEERRAALDSSSVFVPSCEAGGRFSPKQCQQGALCWCVDPTGRQLTGPRRPGDGLVCGE
DEPRCCSRSKRRTDSPLTPPPGSGPADCPARRRLALSRLFSGPVRPPRASSGSAVSCVSL
LRPLRVLGYSDPTSFLARLVEVLQGLFPSVGGALEALTRSPARRLQENLFGGKFLQNAAA
FNYTGVLGPRGAVGLDQLSAQSLQENRDLVRSVSRALEDPAFLSALSTSYRTGQTLLGLS
HVVLSAYSGYQCSLRANTSALTQSGLITGCHGDSLLSSTVDARQCDLLGSWVLDEVLRSC
SEEEDDSSSLFVPRCSPSGGYQPVQCRDAECWCVDPQGQEAPGSRTAGRPARCPTSCETA
RATAMKVKSNMAAGAEIHIPACSEDGDFLPLQCIADRCFCVDGKGRKMAAGPTGGAVTCQ
TCLFTMKEQSFISSSVNQVQRIKRWSFTRLQVRAETFNLEIPHFLSEHTSLPVDSATSEC
SFDLPGRCSKALAEVTAFRQEVDSLVFLSNSTHFPVGYGFLLAEGLSLSQSEEELRLSQS
EELKVSERFLSRSRSALRLAASSRITLSLPQQTHIGSEYELVTSLMTSSALPQCDAAGNW
RLTQCYHSTGQCWCVDEEGEFIPGSLRRSLRLPRCKSRCQRAEAHSLLSDWMKASDITTA
SPYHPQCDFQDGRFSVLQTGGAAGWCVNPLTGETLQSASRSAAGELTCQSPSPSSLSLPL
RSGLSPSLALGSAVCRLCCSASWPAGGSALLRPGSDPARFLSQLPSGRSVALCGDSAVGL
WCDAGDSVRLTLRWTADLSDLTTSDLPHLHHMGEYSLNRDSNFSFSVTKQISISDEQQIS
CHKFKSKLKVVIISKGCFNYYHRSVFVLRFADFTDALDSRSNLFSRNIYFHNSGVLNVTV
FRRQLHWNMCNVSQMSFISFFPSAIFLNESRLLEGVQGILGNLRSLLTSDPKLVLVALPT
FGCSHGYRLSSDGAGCVICPAGSFHQQGACLLCPQGTYQELEGRDFCTRCVRGSSPAGAS
AANQCETDCERRGLRCTQRGDFLPAQPNFLSGGWRCVSSEGAELEWTSREERLADEECSV
LSLFQAVPGSDLMVGTGDTDVLRTITSDLSACLHACAAEPSCHHVALFDRRTRCDLYSSL
NVVCSASQQARGFLGNPRAERFHKLRCSLSVRGGASDLLVLRKNGAELQQQSFVRMRMRK
AVSGVFRTQVFSSRNTSLSDARRFCQDGCSRDACCHGFILNQNVLDGGSLLCGWLRAPSV
LMCEDEDWDVIGQGPANRICGAGLSYSEQQRSFELDFGGEKFTITDGALPGDSRTRKDYQ
ATIISFQAIYLNTAAAAGGSGSASCGAAEVPAPLNGSIRSDDDDGFPDESSVQLRFQSLS
SADVLVDPQRKQPVLSFWLSKNDYSSQNALLWCLTRCDEEERCSVADLRDAESHRFFLCS
LYPDTRVCGGYDRPIKRSCRPLLDRATNNTYSKKVDLNGPVQSFYERVPFQKMVSYSVRN
RATLGQNQLLPDGFRECERRCDEDPCCRGFGFVRETKSRVSGRLCLPLVSLGVLTCSEDD
ASTWTTQDCSPPEAETSPEPFGWYQKPVNQWTSSPALCPPFSLRDRRNNESVSVSMDDWR
LLSESSLLIDASLSTYDVIHVSRDIDTDRERTRDWCLHACQEAESCVAVSLREAESAVRC
ILYPDTTTCGLSSAPDSISPASSCRLVVKEPAPQVYLRTGELMSQSQSRKAASVSVPGHG
TLQGVAMETAVGSDRRTVIRFLGVPFARPPIGALRFEAAQPADWTGTWDATKPRPSCVQP
GDDEDSASSEDCLYLNIFTLAAQRGRVPVLVYFFNPPANQNQNQNLLDGSALAALGNVVV
VTASYRTAALGFLTAGGLHGNYGLSDQEAALRWVHAHISLVGGDSGSVTVGAERRGADIS
SLTLLSSSPPFHRMILMGGSVFSPSLVQTAAAGRRQAVDLARELGCVTSDPSDDGPMVAC
LRSTPVHKLNAAQTKLLAVSGPFQSWAPVRRFESESFHRVDLMLGTSEHDGLISRARRIK
NFEALQGRADGKTAFYEALSRSLGGASGNALLKDAAAWFYALDHEPSAAGYNLFSRALNN
ATRDLFIVCPTVQMALHWAASGTNVFQYHQPASSAQDRADVSVPLDVQFLFGIPLQPMSS
QHFTSSDRRLSLAVMTYASSFIRTGNPNPSRVWAESVLPRWQPVTAEAPPTYLELSPALQ
HQQGLRQNACSFW
Download sequence
Identical sequences M3ZZC8
ENSXMAP00000007572 ENSXMAP00000007572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]