SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000007813 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000007813
Domain Number 1 Region: 175-264
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.28e-23
Family Thyroglobulin type-1 domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000007813   Gene: ENSXMAG00000007791   Transcript: ENSXMAT00000007821
Sequence length 276
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556740.1:18102:32905:1 gene:ENSXMAG00000007791 transcript:ENSXMAT00000007821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKARTPPTMLWFTGCSLLLLSAPFAGASLSEMVFRCPGCTAERHVVLEKATADLSFLILL
PSRGCSAFCYKKKFRLCHLWPTCHLGIRHGSDTESSLATEQMRMDYSKCARVLMCRVKGE
ALELQPDLDASEIPAARKPSKDAAWLGPKESAVRQHRQEMKTKMKTNKVEEVRPTRPKQT
QCQQELDQVLERISKMPFRDNRGPLEDLYALHIPNCDKRGQYNPKQCKMSLHGQRGECWC
VDPHTGQRILSAPAVRGDPNCSQYLSELELPDATQI
Download sequence
Identical sequences M4A019
ENSXMAP00000007813 ENSXMAP00000007813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]