SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000008014 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000008014
Domain Number 1 Region: 38-136
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.22e-20
Family Hormone receptor domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000008014
Domain Number - Region: 117-406
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0403
Family Rhodopsin-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000008014   Gene: ENSXMAG00000007989   Transcript: ENSXMAT00000008022
Sequence length 460
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556740.1:1245840:1255823:1 gene:ENSXMAG00000007989 transcript:ENSXMAT00000008022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSRIVLLLALLSFDELPVEATTDDDRGNGTHVSLQWLRQRIAVSQFRCFQRITRGSDR
KINSNGTAINHCNATWDGWLCWGDTEPGATEQNCPDYFDDFDTRAIAVKVCTETGEWARH
PDSNRTWTDYTSCKPDKTNWTLTAMIHFYLILIGHGLSLVSLLVSLGIFFYFKTLSCERI
TLHKNLFLSFVLNSVITLTWFCINKDSLSSQGSCKILAFIHMYIMSCNYFWMLCEGIYLH
TLIVVAVFAEKQHLMWYYLLGWGFPLVPAVIYSIARTCYYDDKCWVSSATSLLYIIHAPI
CAALVVNFFFLLNIIRVIITKLRVTHQAESSLYMRAVRATLILIPLLGIQYVLLAYQPHS
HWISEIYLYIMNILMHYQGLLVSTIFCFFNGEVQTVLRRQWNLLRMQSAGTFANPEFFRS
AYYVASSLTEVHRCYSIESHTEHMNGKSYSDIFRSEGPYV
Download sequence
Identical sequences M4A0M0
ENSXMAP00000008014 ENSXMAP00000008014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]