SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000008391 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000008391
Domain Number 1 Region: 122-241
Classification Level Classification E-value
Superfamily EF-hand 2.62e-34
Family Osteonectin 0.025
Further Details:      
 
Domain Number 2 Region: 211-304
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.44e-29
Family Thyroglobulin type-1 domain 0.00058
Further Details:      
 
Domain Number 3 Region: 59-103
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000721
Family Ovomucoid domain III-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000008391   Gene: ENSXMAG00000008356   Transcript: ENSXMAT00000008402
Sequence length 367
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556664.1:626372:654710:1 gene:ENSXMAG00000008356 transcript:ENSXMAT00000008402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DATKDPCLRVRCPPHKVCISHDFQTAICTNNKQPSHSVKARKGSVGHRPGVEPGPPGKCR
LCSASQASPLCGSDGHTYSSKCKLEFQSCLSGKTISVKCDGQCPCLPGQEFSKPSHNTEK
AGCSDAELHSLAARLKDWFGVLHLDANRDLKSSDSFDSTTGHFDTSILPICKDSLGWMFN
KLDMNFDLLLDQSELSAIYLDKYELCMKPLFNSCDSFKDGKLSNNEWCYCFQKPEGLPCQ
TEKSRIQNQSRRKSLIGSYIPRCTEEGYYKPTQCHGSTGQCWCVDKYGNEIAGSRKQGNP
NCDEDPETSGDFGSGGAVILLDDQEEEPSHSERSRQKKRRGRIHPRGTIEDDEDEDEDKD
DETGYIW
Download sequence
Identical sequences M4A1P7
ENSXMAP00000008391 ENSXMAP00000008391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]