SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000008675 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000008675
Domain Number 1 Region: 125-191
Classification Level Classification E-value
Superfamily Class II MHC-associated invariant chain ectoplasmic trimerization domain 2.88e-24
Family Class II MHC-associated invariant chain ectoplasmic trimerization domain 0.0013
Further Details:      
 
Domain Number 2 Region: 187-257
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.19e-21
Family Thyroglobulin type-1 domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000008675   Gene: ENSXMAG00000008646   Transcript: ENSXMAT00000008688
Sequence length 281
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556664.1:1153123:1156602:-1 gene:ENSXMAG00000008646 transcript:ENSXMAT00000008688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNQEHAPLSRGSVSGSHEVLVNNAGPRGGSNSRAFTIAGLTTLACLLLASQVFTAYMV
LDHKQQIHSLQKNSERMSKQMTRVSQGVAPARMAMPMNSLPLQLDFTEDDTSSKTPLTKV
EDIAIVSVEKQVMDMMKDISLPQFNETFLANLRSLKQQFNDSEWKSFESWMRYWLIFQMA
QQEPAGPTPQPASTIKSKCQMEATPGVGKIGAYKPQCDEQGHYKPMQCWHATGFCWCVDQ
SGNPIQGTTMRGRPDCQRGAGFRRMMVAPRMMQKTFLEDGA
Download sequence
Identical sequences M4A2I1
ENSXMAP00000008675 ENSXMAP00000008675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]