SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009171 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009171
Domain Number 1 Region: 12-356
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.11e-64
Family Rhodopsin-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009171   Gene: ENSXMAG00000009156   Transcript: ENSXMAT00000009185
Sequence length 384
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556918.1:151071:155091:1 gene:ENSXMAG00000009156 transcript:ENSXMAT00000009185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSWPNDSECLPRNCSWEETYNTTSSADQPAPPLNYYSIPLLTFITVACSLLFLVGVAGN
VMTILVVSKYRDMRTTTNLYLCSMAVSDLLIFLCMPLDLYRMWRYRPWRLGDALCKLFQF
VSESCTYSTILNITALSVERYLAICFPLRAKALVTKRRVRALICVLWTVSLFSAGPVFVM
VGVERDNVEPLNLTSRINTTGLLLDVGDTRECRMTHYAVESGLMGAMVWLSSVFFFMPVF
CLTVLYSLIGRRLWQRHRETNMSSRVAHRDKSNRQTIKMLVVVVLAFVLCWLPFHVGRYL
QFRFLDAPSPLLSLLSEYCSLLSVVLFYLSAAINPILYNTMSWKYRGAAARLFGLTDGQP
SRCRTASTLKGDGSSGWTESTVSF
Download sequence
Identical sequences M4A3X7
ENSXMAP00000009171 ENSXMAP00000009171 XP_005809393.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]