SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009543 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009543
Domain Number 1 Region: 111-199
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.88e-23
Family Thyroglobulin type-1 domain 0.00012
Further Details:      
 
Domain Number 2 Region: 58-100
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-16
Family Growth factor receptor domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009543   Gene: ENSXMAG00000009527   Transcript: ENSXMAT00000009557
Sequence length 201
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556729.1:1993723:1997690:-1 gene:ENSXMAG00000009527 transcript:ENSXMAT00000009557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLSNLTAVVLLLIAHCGSWAGGSRWGPFKVCPSCKDPLGVGRPPRDHDVAGSTTVLAQ
GEPCGVYTLSCAKGLRCMPPPREHSPLQALLQGRGVCAKHIRTSPTERPHPTGPHPSHFG
DLEKAPCRKLLNSVLRGLELTIFQSDRDIYIPNCDTRGFYRKKQCRSSKGMQRGHCWCVD
ELGAPVPSRAREDGTLPCDGE
Download sequence
Identical sequences M4A4Z9
ENSXMAP00000009543 XP_005801963.1.87360 ENSXMAP00000009543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]