SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009808 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009808
Domain Number 1 Region: 235-429
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.49e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.00000124
Further Details:      
 
Domain Number 2 Region: 62-202
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 8.63e-22
Family CRAL/TRIO domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009808   Gene: ENSXMAG00000009779   Transcript: ENSXMAT00000009822
Sequence length 430
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556865.1:519132:529097:-1 gene:ENSXMAG00000009779 transcript:ENSXMAT00000009822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSELLVDLGDDAATAQLGQLKLSTLEDQQWPPDESSLSKSETENSQGFDPGSPHLPWDH
PFYDIARHQIIEVAGDDNFGRKVIVFSACRLPPQHQLDHQKLLMYLKATLDQYVESDYTL
IYFHHGLTSENKPSFGWLREAYKEFDRKYKKNIKALYIVHPTMFIKTLLILFKPVISFKF
GRKINYVSYLSELEDVVKCDQLVIPTRVREYDNKLRASLKPSSLPSMSPPHSPPLPEQLF
GVSLVMLRQKDPDNHLVPVVMRDTISFLSEQGLDIEGIFRRSANVTLVKEVQLKYNSGAT
VNFRDMEDVHLAAVILKTFLRELPEPLLTYQLYNDIVNFTSVSSDNQAEVMKTLVESLPE
ENYASLRYLITFLARVSANSEVNKMTNSNLAVVFGPNLLWGRDNAMSLSAIGPINNFTRT
LLDQQHLVFT
Download sequence
Identical sequences M4A5R4
XP_005807874.1.87360 XP_014327523.1.87360 ENSXMAP00000009808 ENSXMAP00000009808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]