SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009812 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009812
Domain Number 1 Region: 1032-1297
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-55
Family YWTD domain 0.00000174
Further Details:      
 
Domain Number 2 Region: 2787-3045
Classification Level Classification E-value
Superfamily YWTD domain 9.81e-54
Family YWTD domain 0.00000267
Further Details:      
 
Domain Number 3 Region: 1652-1907
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-46
Family YWTD domain 0.000014
Further Details:      
 
Domain Number 4 Region: 3630-3906
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-45
Family YWTD domain 0.00000825
Further Details:      
 
Domain Number 5 Region: 301-543
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-39
Family YWTD domain 0.00000762
Further Details:      
 
Domain Number 6 Region: 1347-1601
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-39
Family YWTD domain 0.0000357
Further Details:      
 
Domain Number 7 Region: 35-237
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-37
Family YWTD domain 0.0000998
Further Details:      
 
Domain Number 8 Region: 1961-2230
Classification Level Classification E-value
Superfamily YWTD domain 1.26e-36
Family YWTD domain 0.0000445
Further Details:      
 
Domain Number 9 Region: 2709-2779,3040-3099
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 10 Region: 3543-3623,3907-3946
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 11 Region: 936-1024,1290-1342
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000267
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 12 Region: 653-695
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000301
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 13 Region: 3127-3171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000615
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 3324-3367
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 15 Region: 612-650
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00017
Further Details:      
 
Domain Number 16 Region: 738-775
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 17 Region: 3369-3405
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 18 Region: 2453-2489
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 19 Region: 778-816
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000733
Family LDL receptor-like module 0.0001
Further Details:      
 
Domain Number 20 Region: 3290-3329
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000798
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 21 Region: 3412-3456
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000929
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 821-861
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.00014
Further Details:      
 
Domain Number 23 Region: 693-732
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000982
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 24 Region: 3206-3243
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 25 Region: 2532-2566
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 26 Region: 2357-2398
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 27 Region: 2662-2703
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 28 Region: 2492-2526
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 29 Region: 2575-2610
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 30 Region: 3245-3285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 31 Region: 3457-3491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000995
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 32 Region: 2318-2359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000106
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 33 Region: 3169-3207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 34 Region: 3090-3123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 35 Region: 3497-3534
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 36 Region: 2612-2651
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000072
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 37 Region: 907-945
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 38 Region: 1606-1656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000161
Family EGF-type module 0.011
Further Details:      
 
Domain Number 39 Region: 2282-2320
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000511
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 40 Region: 870-904
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000511
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 41 Region: 1914-1964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000801
Family EGF-type module 0.017
Further Details:      
 
Domain Number 42 Region: 2417-2448
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000038
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 43 Region: 3960-3993
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000037
Family EGF-type module 0.037
Further Details:      
 
Domain Number 44 Region: 3996-4031
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000768
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000009812
Domain Number - Region: 4032-4066
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000137
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 4069-4102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000138
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 4141-4176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000168
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 570-612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00067
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 254-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0055
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009812   Gene: ENSXMAG00000009715   Transcript: ENSXMAT00000009826
Sequence length 4314
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557425.1:9086:79891:-1 gene:ENSXMAG00000009715 transcript:ENSXMAT00000009826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFVYAKETVCWIHVGDSPSSTHLKCASIPNLKSFTEERVINISFSLHHVEQMAIDWLTG
NFYFVDDVDDRIFVCDKDGQTCVTLLDQELYNPKGIALDPNMGKVFFTDYGQIPKVERCD
MDGQNRTKLVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKNRHTIIQGLLIEH
LYGLTVFENYLYATNSDNANMQPKTSVIRINRFNSTDYQVVTRVDKGGALHVYHQRRQPP
VRSHACEVDQVGKAGGCSDLCLLGNGHKTRTCRCRSGFSLGSDGKSCKKPEHELFLVYGK
GRPGVIRGMDIKAKVPDEYMIPIENLMNPRALDFHAESEFIYFADATSYIIGRQKIDGTE
RDTILKEGIHTVEGIAVDWMADNLYWTDDGPKKTISVARLEKASQTRKTLIEGKMTHPRA
IVVDPLHGWMYWTDWEEDPKESKRGKIERAWMDGSNRNVFLTSKTVLWPNGLSLDIPQGM
LYWVDAYYDRIEMVYLNNSGRKTVYEGQELNHAFGLCHYSHFLFWNEYRSGSIYKLDTTT
GTTTLLRNERPPIFEIRMYDAQQQQGSNACRVYNGGCSSLCLAIPGGRQCACAEDQILDP
ADNTSCKVNPSYVPPPQCQPGEFACKNNRCIQERWKCDGDNDCLDNSDETLELCHQHTCP
ADRFKCKNNRCIPLRWLCDGDNDCGNGEDESNTTCSARTCPPNQYSCHSGRCIPSSWMCD
LDDDCGDRSDEPASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCRHSCS
STQFKCNSGRCIPDYWTCDGDNDCGDYSDETHANCTNTATRPPGGCHTDEFQCRMDGLCI
PLRWRCDGDTDCMDMSDEKNCEGVTPMCDPAVKFGCRDSARCISKAWVCDGDSDCEDNSD
EENCEALVCKLSHHVCASNSTICLPAEKICDGHDDCPDGSDEKLCDLCSMNNGDCSHNCT
VAPGEGVICSCPLGMELGSDNKTCQIQSFCAKHLKCSQRCEQDKFSVKCSCYDGWELEPD
MENCKSKDPFKPFIIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSSLYWTDVV
EDKIYRGKLSENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTM
RTTLLAGEVEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGEGRKTIHKETGSGGWPN
GLTVDYLERRILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWR
TNTLAKANKWTGNNVTVVQRTNTQPFDLQVYHPSRQPQAPNPCAAKDGKEPCSHLCLINY
NQTFSCACPHLMKLGTDKRTCFESRQFLLYARQIEIRGVDIDNPYYNYIISFTVPDIDNV
TVVDYDALEHRIYWSDVRTQTIKRAFINGTGVETVVSADLPNTHGLAVDWVSRNLFWTSY
DANKKQINVARLDGSFKNAVIQGLDKPHCLVMHPMLGKLYWTDGDNISMANTDGSNRSVL
FINQKGPIGLSIDFDTAQLYWISSGNSTINRCNLDGSGLEVLEGTKGKLVKATALAIMGD
KLWWADQGTDQIGTCDKKDGGNWKVLRNSTSPMMYMKIYNETVQKGTNFCSKNNGDCSQL
CLPTSHNTRACMCTAGYSLRTGQQSCEGVGSFLLYSVHEGIRGIPLDPSDKSDALVPVSG
TSLAVGIDFHADNDTIYWVDMGLSTISRAKRDQTWREDVITNGIGRVEGIAVDWIAGNIY
WTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDG
SQRAILVNASISWPNGISIDYEDGLLYWCDARTDKIERINLETGENREVVLASNNMDMFS
VSVFEGYIYWSDRTHANGSIKRGNKDNASDSVSLRTGIGVQLKDIKVFNRARQQGTNVCK
VNNGGCEQLCLYRGNGQRTCACAHGMLAEDGRGCRDYDGYLLYSERTILKSVHLSDENNL
NAPIKPFEDPEHMKNIIALTFDYRGGGGKGANRIFFSDIHFGNIQQISDDGSDRKTVVEN
VGSVEGLAYHRGWDMLYWTSYTTSTITRHNVDQSRWGAVDRNTVVTMSGDDHPRAFVLDE
CQSLMFWTNWNEQSPSIMRATLGGSNVLVIIGTDIRTPNGLAIDHRAEKLYFSDATLDKI
ERCEYDGSRRYVVLKNEPVHPFGLAVYGDYIFWTDWVRRAVLRADKYTGAEMKVLRADIP
QQPMGIVAVANDTNSCEFSLCRVHNGGCQDLCLLSSEGRVTCGCRGERKLLDDNTCTGAN
STCTGVDEFECGNGDCVNYTLTCDGMAHCKDKSDEKQSYCANRVCKKGYRRCTNGRCVGH
SSWCNGQDDCGDNSDEVFCNTTLCSADQFQCRDGSCISNSSKCNQKVDCEDASDEMNCPP
TDCSSYFHLGVKSVMFQKCEFTTLCYVPSWQCDGANDCGDFSDERNCPGAGRTKCPLPFF
ACPSNRCIPMSWTCDGENDCENGADENNCDKVCSPSQFECKNHRCIFSRWVCDGADDCGD
NSDEDAHCKNKSCSPGTFRCPGSNVCIPQRWKCDGDKDCPDGFDESVTVGCVFNDTCSGD
EFMCQSRECIPKHFVCDHDKDCRDGSDESPECHYPPCGPDSFRCANGSCLLHKSWECDGE
FDCHDHSDEAPKNPHCSSPEKKCNDTAYACSNGKCIAEALLCDHKDDCGDGSDELNCFIN
ECLNRKLSGCSQLCEDLKKGFKCRCHPGFRLKDDRKTCVDIDECTTSYPCTQRCINTHGS
YHCLCVEGFQLSPENPTICKSVSDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAVAL
DFDYRQQMIYWTDVNTQGSMIRRMHINGSNVQVLHRTLLNNPDGLAVDWVGGNLYWCDKG
RDTIEVSKLNGAYRTVLVNSGLREPRAIAVDVRYGYLYWSDWGDNPHIGRIGMDSTNRSV
IIKDKITWPNGLALDFINDRIYWADAREDYIAFASMDGTSRHTVLSQDIPHIFAMTLFEE
YIYWTDWETKSINRAHKTQGTNKTMLISTLHRPMDIHVFHAYRQPDVAGHPCQINNGGCS
NLCLLSPGGGYKCACPTNFYLAADGKRCLSNCTASQFVCKNDKCIPFWWKCDTEDDCGDR
SDEPADCPEFKCKPGQFQCGTGICINPAYICDGDNDCQDSSDEANCDIHVCLPSQFKCTH
PNRCIPGIFRCNGQDNCGDGEDEKDCPEVTCAPNQFQCAMSKRCIPRVWVCDRDNDCVDG
SDEPANCTQMTCGVDEFRCKDSGRCIPALWKCDAEADCSDASDEPKDECDERTCEPYQFR
CKNNRCVPGRWQCDYDNDCGDNSDEEKCVPRKCSESEFACTNGRCIAGRWKCDGDHDCAD
GSDEDGCEVRCNSDQFQCQSGHCIPIRWRCDSDVDCIEGSDEENCDSPVDKHCFHDEFQC
NNTLCKPLNWMCDGEDDCGDNSDENPAECVKFLCPPTRQFRCLNDRVCVPVSKRCDGVNN
CGDNSDELNCPTHPLKPVCQKNQFQCSNGRCISTDLLCNHFNDCEDYGSDEMSCEKKADT
TLNECRSNVTMCGDGDEAHCVINGTVSFCSCKPGFQSSGQNRCQDKNECKQFGVCSHICN
NTKGSHKCSCHKYFSKINNTCKADAQGHVLYLGDDNEIRSLDASVPNWRYELTFQGDANV
RIDAMDLHVKTNRLYWTNWHIGRISYFDLPSSSSSQNSNRNRRQTDSRVINFEIPELKMP
RGIAVDWVAGNLYWTDSGRDVIEVAQMSGGRHHKTLISGMIDEPHAIVVDPQRGKMYWAD
WGNHPKIETAAMDGTMRETLVEENIQWPTGLAVDYFNERLYWADAKLSLICSVRLDGSDV
VVAINAQNKLRHPFSIDVFEDHIYGVTYMNNSVFRVNKFGRGPLENLANGVNHATDLVLH
HRYKQPDVNNPCDRKKCEWLCLLSPSGPVCTCPNGRTLDNGTCVELPTPTLSPLSPPSGP
CNIQCMNGGSCILNAHKQPKCRCQPNYRGDRCEIDQCKDYCRNGGTCTPSYTGSPTCRCP
TGFTGPTCNLHTCKNYCKNGGNCTVSAGNQPTCRCPADFLGDQCQYRSCEGHCLNGGTCL
QSETGAKSCRCLPQYIGDACEIDKCHYCRDGECIPKDRFVTTGDFTCRCPNGRNQPSCYT
CDPNEYCANGQCSINPITLLPECRCSAGWSGHRCESVANTTESTGSGGRTASIVVTVLIL
LLLVLLAAGALLWYRKRMRGAKGFQHQRMTNGAMNVEIGNPAYKIYEGEPDDDAGELLDA
DFTLDPDKPTNFTNPVYATLYMGAHNSRNSLASTDEKKELLSRGDEEPLVDPLA
Download sequence
Identical sequences M4A5R8
ENSXMAP00000009812 ENSXMAP00000009812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]