SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009911 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009911
Domain Number 1 Region: 46-254
Classification Level Classification E-value
Superfamily Macro domain-like 3.14e-48
Family Macro domain 0.00018
Further Details:      
 
Domain Number 2 Region: 330-470
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000034
Family CRAL/TRIO domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009911   Gene: ENSXMAG00000009875   Transcript: ENSXMAT00000009925
Sequence length 495
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557294.1:94748:119226:1 gene:ENSXMAG00000009875 transcript:ENSXMAT00000009925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLGARSQFVDIQSLPVWQQQPSEEAKETPLDQGDGPLGHEAFPSPFPFRPDINRKIIL
YTGDVALLNCTAIVNTSNESLNDKNPVSDGIHQLAGPELREELIKLKGCRTGEAKLTKGF
NLAARFIIHTVGPKYKAKYRTAAESSLFSCYRNVMQLAAEQSMASVGFCVLTTTKRGYPL
EDAAHIAFRTVRRFLENHGNSIDTVVFAVSDTEESVHKKLLPLYYPRSEEEERRCLPLIP
ADIGNSEGEPVVPERQIRIAEKPGSLEDECEEENLELDLGQVGNHAFARMEGDVDKQRKL
ILQGQMSEAAVQKQHQRNYSRWLCRARAEDLSDVAALKALYQTGVDICGRTVMVVVGRNI
PVTLIDLEKALLYFIHVMDHITVKEYVIVYFHTLTGEHNHLDSDFLKNLYDVVDIKYKKN
LRAFYFVHPTFRSKVSTWFFTTFSVSGLKEKVRYLDNLPQLFTCIKPEQIDIPPFVLEYD
ARVRTRAKTASHGEM
Download sequence
Identical sequences M4A617
XP_005813845.1.87360 ENSXMAP00000009911 ENSXMAP00000009911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]