SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009997 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009997
Domain Number 1 Region: 27-126
Classification Level Classification E-value
Superfamily Immunoglobulin 7.11e-23
Family I set domains 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009997   Gene: ENSXMAG00000009989   Transcript: ENSXMAT00000010011
Sequence length 128
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556924.1:257304:257719:1 gene:ENSXMAG00000009989 transcript:ENSXMAT00000010011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPPIFSQMTLLAFHFLSGSRLRQEDTPPRIVEHPSDLIVSKGEPATLNCKAEGRPAPTVE
WYKDGERVETDRDNPRSQRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSHN
ASLEVASK
Download sequence
Identical sequences M4A6A3
ENSXMAP00000009997 ENSXMAP00000009997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]