SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000010469 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000010469
Domain Number 1 Region: 8-136
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 4.84e-24
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0091
Further Details:      
 
Domain Number 2 Region: 282-339
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0000000000000012
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000010469   Gene: ENSXMAG00000010444   Transcript: ENSXMAT00000010483
Sequence length 674
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556681.1:3121856:3162200:-1 gene:ENSXMAG00000010444 transcript:ENSXMAT00000010483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGGRFDFDDGGTYCGGWEDGKAHGHGICTGPKGQGEYAGSWSHGFEIVGVYTWPSGNTY
KGYWSQGKRHGLGVENKGRWIYRGEWSHGFKGRYGVRQSHNTPARYEGTWSNGLQDGYGV
ETYGDGGTYQGQWMGGMRHGYGVRQSVPYGMATVIRSPLRTSMASLRSEQSNGAVLHDLS
SPVDTPTGTRGGFVLNFHSDSEVVTGKKKGLFRRGSLFGSLRQLRKSDSRTSISSKRSSA
RSDATMSRISSSDANSTISIGDGELPDEDLPLEDHVDATTTETYMGEWKNDKRNGFGVSE
RSNGMKYEGEWLNNKRHGYGCTVFPDSTKEEGKYKNNVLVRGIRKQLIPLKNPKTKEKVD
RAVEGAQRAAAIARSKVEIAASRTAHARTKSEAAEQASISAVHESEIARAVARELSPNFY
QPGPDYIKQQSKEPVEIKEVPVEKKEESPHDSPHFYRKGTTPPHSPVASPAISHKPSKEE
KPSRKISKEEKSSYKASKDERSSRKLSKEERLSFTDGPKTSHTHIEAPPKPTKVQQPAPA
TAPPVQPPTVPVNGQLHSEYHSYYVKATPRGPPPPEPEEVEEEPSAQALARLPPQPKSFS
TPIPTPKPPSIRDSKSDPKLRKQDSLKPKSLADTNWDSIPAITKIFLQGPNSILVAMVML
LNIGLAIIFVHFLT
Download sequence
Identical sequences M4A7M5
ENSXMAP00000010469 ENSXMAP00000010469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]