SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000011253 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000011253
Domain Number 1 Region: 266-561
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.68e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000262
Further Details:      
 
Domain Number 2 Region: 78-235
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.57e-35
Family CRAL/TRIO domain 0.00024
Further Details:      
 
Domain Number 3 Region: 5-70
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000000458
Family CRAL/TRIO N-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000011253   Gene: ENSXMAG00000011226   Transcript: ENSXMAT00000011267
Sequence length 570
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557992.1:21:31503:1 gene:ENSXMAG00000011226 transcript:ENSXMAT00000011267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATLSAEEEQATRQFLEEINKWTSQHGVSPLSRELAVKFLMARKFDVLRAIELFHNYRE
TRLKEGIVRLQPQEEPLRSELLSGKFTVLSVRDPTGASIALYTAKLHHPNKTGNHVVLQA
LFYLLDRAVESFETQRNGLVFIYDMAGSNYTNFELDLSKKILNLLKGAFPARLKKVLIVG
APVWFRVPYNLLSLLLKEKLRERVQMVKMAELRQHLPRDCLPQHLGGLLPLDASGWNQEL
LAGQNGRVDPVDELVGIPLEDSSIHVPGPEAMRPQELLAHLGRLQRSGVYQEYEELRREA
PPGTFHCSQLAYNQEKNRYGDVLCLDQTRVRLKPRRNERSDYINASFMDGYKQKNAYIGT
QGPLDRTYGDFWRMVWDQNVLLIVMTTRTDEGSRRKCGQYWPLEEGGQEVYGHIAVVNQR
VDHHTHYNHTTLELHNTETCEQRHVSHFQYLSWPDYGVPTSAVTLIDFLGAVKRQQRKMV
KALGPQWTGHSLGPPMVVHCSAGIGRTGTFCALDICLSQLQDVGSLNVFQTVRRMRTQRA
FSIQTPEQYYFCYNAILEHAQRQGLLPSNQ
Download sequence
Identical sequences M4A9V9
ENSXMAP00000011253 ENSXMAP00000011253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]