SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000011338 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000011338
Domain Number 1 Region: 3-173
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.81e-53
Family G proteins 0.000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000011338   Gene: ENSXMAG00000011307   Transcript: ENSXMAT00000011352
Sequence length 188
Comment pep:novel scaffold:Xipmac4.4.2:JH556704.1:3148:8472:-1 gene:ENSXMAG00000011307 transcript:ENSXMAT00000011352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNIKCVVVGDGSVGKTCMLMSYTSNAFPGEYIPTVFDSYSANVMVDENPVALCLWDTAG
QEDYDRLRPLSYPQTDVFLLCFSLVGPPSFENVRARWIKELHHHCPTTPIVLVGTKVDLR
NDSEALEEEKLTPITTVQGFAMAKEIGAAKYLECSALTQRGLKTVFDEAIRTVLLAPKVQ
KKRRCQIL
Download sequence
Identical sequences M4AA44
XP_005800077.1.87360 ENSXMAP00000011338 ENSXMAP00000011338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]