SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000011400 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000011400
Domain Number 1 Region: 442-702
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-58
Family YWTD domain 0.0000000422
Further Details:      
 
Domain Number 2 Region: 29-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 3 Region: 238-274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000798
Family LDL receptor-like module 0.0006
Further Details:      
 
Domain Number 4 Region: 64-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000089
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 5 Region: 272-313
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000982
Family LDL receptor-like module 0.00033
Further Details:      
 
Domain Number 6 Region: 324-436,707-746
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000361
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 188-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 8 Region: 153-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 105-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.00083
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000011400
Domain Number - Region: 763-849
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0118
Family Phase 1 flagellin 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000011400   Gene: ENSXMAG00000011361   Transcript: ENSXMAT00000011414
Sequence length 977
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556792.1:1010428:1171726:1 gene:ENSXMAG00000011361 transcript:ENSXMAT00000011414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTGVGKLVLLHLLLMELSGHAKGTHTESECEIGQFQCKSGVCIPSLWRCDDDNDCSDSS
DEENCPKKTCATTDFACKNGQCLPARWRCDGEPECADGSDEADAICSRQTCPPEKFDCGG
VASKCVSLSWRCDGERDCENGADEEECPADENACPSKDFHCRNGKCVAPIFVCDGDDDCG
DASDEDKCSSPTCGQHEFRCNDSECIPALWSCDGDPDCKDKSDESMERCSRRTEPQKPGC
PGEFQCSSGECVHMHWKCDGDADCKDKSDEANCPLLTCRPDEFQCGDGSCIHGTKQCNKV
HDCPDYSDEAGCVNVTKCDGPKKFRCKNGECIDSSKVCDSVKDCKDWSDEPVKECGLNEC
ADNNGGCSHICRDRRIGYECDCPSGYKLLDKKTCGDIDECENPDACSQICINYKGDYKCE
CYEGYEMDPASKTCKAVGKSPCLMFTNRHEIRRIDLLKSEYTQVVPTLKNAVALDVDVST
NKMFWCDLYHRKIYSAYINKASDSSQQVTLVDSLHSPEGLAVDWVHKNIYWTDSGNKSIS
VATGDGRKRKVLIATELSEPRAIAVDPHQGFMYWSDWGDQAKIEKAGMNGVDRQVLVSDH
IEWPNGITLDLSNRRLYWVDSKLHLLSSVDLNGDNRKVLLSSHHHLGHPFALTVFEDRVY
WTDLEDEAIYSANRLTGHDVAKVAEDLNNPLDLVVFHEQRQPKAPDTCNMGSLPNGGCEY
LCLKAPQITDHSPKYTCACPDGMELGPDMRRCAVVRIRTTTTVAPTTTSTTIATTTTATT
TTTTSPATSTTTRTPTTTSTTTSAATPPRTTTRHHMTPKPPQTSRSSRITQPPVTQAATS
TEATSLSSTSQMSTQTPLLDPVAPDSIQRETNANLSHRAASDHYLIGNNITVAVLGIVIP
IVPILATVVIGLLCTGGYLVWRNWRRKNTKSMNFDNPVYRKTTEDDDDEIHIGRHSDSIG
HVYPPRVALSLEDDGYP
Download sequence
Identical sequences M4AAA6
ENSXMAP00000011400 ENSXMAP00000011400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]