SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000011559 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000011559
Domain Number 1 Region: 66-321
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-43
Family YWTD domain 0.0000169
Further Details:      
 
Domain Number 2 Region: 961-1229
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-32
Family YWTD domain 0.0000799
Further Details:      
 
Domain Number 3 Region: 2-58,314-375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000895
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 532-568
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000707
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 5 Region: 486-523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 6 Region: 403-447
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 651-688
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 8 Region: 567-607
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 9 Region: 690-733
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000105
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 610-646
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 445-482
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 12 Region: 366-401
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 13 Region: 732-776
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 14 Region: 819-856
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 15 Region: 1447-1488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000059
Family EGF-type module 0.029
Further Details:      
 
Domain Number 16 Region: 778-810
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000694
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 17 Region: 862-942
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000157
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 18 Region: 1347-1381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000168
Family EGF-type module 0.033
Further Details:      
 
Domain Number 19 Region: 1311-1349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000101
Family EGF-type module 0.013
Further Details:      
 
Domain Number 20 Region: 1272-1311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000108
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000011559
Domain Number - Region: 1384-1417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00264
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 1234-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0247
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000011559   Gene: ENSXMAG00000011528   Transcript: ENSXMAT00000011573
Sequence length 1668
Comment pep:novel scaffold:Xipmac4.4.2:JH556954.1:3164:62386:1 gene:ENSXMAG00000011528 transcript:ENSXMAT00000011573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCKCWPGFHLKDDGKTCVDVDECSTTLPCSQRCINTYGSYRCLCVDGYEPVDRNPNTCKA
ISAEEPFLIMADHHEIRKLSVDGSNYTILKQGLYNIIHLDFDYKKEFIYWVDSTRPSGRK
INRMRLNGSDLKIVHRTAVPSALAVDWIGKNLYWCDAEKKTLEVSKANGLYPTILISSGL
KNPTDLALDPQTGYVFWVDCCEPSQIGRIGMDGRGQMVIIDTEIYSPTALTIDYTNKRLY
WADDNHILFANMDGTQRRKVSYDHIQGVMALTLFEDFVYWTDGKSKSLRRAHKTTGTQAI
ELLNSWQAIKSIKVYHSLRQPEVPKHQCQIANGGCSHLCLLSPGGEHKCACPTNFYLAAD
NKTCLSNCTSSQFRCGTDECIPFWWKCDTVDDCGDGSDEPPDCPEFKCQPGRFQCGTGLC
ALPPFICDGENDCGDNTDEANCETYICLSGQFKCTRKQKCIPLNLRCNGQDDCGDGEDET
DCPESTCSPDQFQCKASMHCISKLWVCDEDPDCADGSDEANCVLAPDEKDEKTCGPHEFR
CENNNCIPDHWRCDSQNDCGDGSDEENCKPVTCNHKDFACANGECISSRFRCDGDYDCLD
NSDERGCEARCADDQFRCHNNLCISLKWLCDGQEDCKMGEDEKNCHGTVGPSCSVNEYVC
ASGGCVSASLRCDGHDNCLDGSDEIGCVKECREDEFLCLNRAHCIPRRWRCDDVLDCMDH
SDEENCNHGTFFCRADEFICNNTLCKLHTWVCDGKDDCGDNSDEDAEMCAKLPCPPTRPF
RCRNDHVCLRMDQVCNKVDDCGDNSDEEECAEVVAGRPRPCGKTEFTCSNQRCIPMQLQC
DLFNDCGDGGSDEQDCKSFSSGDVCGKKTNPCGEDAICNQTNANAICQCKPGFKRNQKTG
QCEEMNECLQFDTCPHYCTNTKGSYKCTCDRNYKEMNGNCVVKGQDDRVLYIANDTEIRS
FVYPYNQSQGHKLLTHIEDNARIIGMDVLFHQQKFIWATQFNPGGIFYKDTLERGQTKAN
VKNICSDFRRPRDISADWITGNIYWTDHSRMHWFSYYTAHWTKLRYSINVGQLKGPNCTR
LITDIAGEPYAITVNPARGMMYWSVIGDHSQIEESAMDGSLRRVLLEKNLRRPTGLAIDY
FNQRIYWADPELSQIGSMRLDGSDPLVTISDRHGISQPYRIDLFEDYIYGTGLKHELFKI
HKYGKQAVEILYLGVERPTNVFVAHRYKQQDASNPCLRMSCDFMCLPNPTGARCICPEGK
VLVNGTCNDINNSGELCRPPCENGGRCLANEKGDWRCYCWPDFSGERCEVNHCTDYCLNG
GTCMGSPLGKPTCRCPIGYSGPFCEKRICDNYCLNGGTCDVTQGNQPVCRCMAEYTGDRC
LYHICHHYCVNSKACTLSSSGYVECVCPARYEGNKCEVDKCLRCHGAPCLINEETLDVVC
NCTNGRIAPSCQLCDGYCYNGGTCHLDPDTSLPFCQCSANWAGTQCERPAPKSSRSDNTS
GGSIAIIVPLVLLVILIVMVVAGVYICRRRQRGKRVQRQPMTNGGINVEIGNPSYNMYEV
DHDNHADAGSLLRPNFTLDPHKSYFIEGIYNILLLRFEHPQAPIFVNGYEISLLTPFVFP
MQPMNYSNPVYAKIYIDGQNCRKPVISIDERRELLPKKLEGTIRETAA
Download sequence
Identical sequences M4AAR5
ENSXMAP00000011559 ENSXMAP00000011559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]