SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012068 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012068
Domain Number 1 Region: 861-1149
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-21
Family YWTD domain 0.0074
Further Details:      
 
Domain Number 2 Region: 499-576
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000012
Family Pre-dockerin domain 0.078
Further Details:      
 
Domain Number 3 Region: 1121-1261
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000196
Family All0351-like 0.06
Further Details:      
 
Domain Number 4 Region: 336-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000377
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number 5 Region: 305-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000044
Family Integrin beta EGF-like domains 0.068
Further Details:      
 
Domain Number 6 Region: 239-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000681
Family Integrin beta EGF-like domains 0.078
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000012068
Domain Number - Region: 172-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0011
Family Integrin beta EGF-like domains 0.046
Further Details:      
 
Domain Number - Region: 143-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00456
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 207-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00576
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 368-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012068   Gene: ENSXMAG00000011925   Transcript: ENSXMAT00000012084
Sequence length 2232
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556942.1:543853:679688:-1 gene:ENSXMAG00000011925 transcript:ENSXMAT00000012084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGRAIDRGEIDVGTQQSQAIPPGLFWRFHMTVHHPTYVKFNLSLSHNALLGVYGRRNIPP
THTQFDFVKLLDGKALPRSLTDPVSTAKTPKGLLLSGLQETGFIEYMDPGTWHLALYNDG
RNLEQVLLHSTPIDSMDGCSTDCNGNGECVAGHCHCFAGFLGPDCAKDSCPVLCSGNGMY
EKGRCVCLPGWKGAECNVEEGQCIDPTCSNHGNCIQGICICSPAYKGVNCEQVDCADPQC
SGHGVCVRGECVCSAGWAGVSCDDPLPACQEQCSGHGTYLPESDTCACQPNWTGPDCYTE
LCPVPCGSHGVCSEGQCQCEEGWIGAACDQRACHPRCEEHGQCHDGTCICQPGWEGEHCN
IVFWSQSLKYGCPGLCSGHGRCTLEQSGWRCICQAGWSGPGCSVVMETDCSDGTDNDGDG
LIDCVDPDCCEQLSCGSDPLCHGSADPLALLQQSPLPSSAPTSTHTHSFYRRIRFLLGKA
ATHTLPGDVPFDTSRVAVIRGNVVLQDGSPLVGVNITFPQHPEYGYTVSRKDGSFDLVTF
GAMSVTLMFQRPPFLPQTRTIWTPNNNFLVLDHVTMAREEAETPKCDIRSVLSPYPLVLP
YPLPRYTGACVEKAPAVPELQAVQEEASIPGAFLKLSYLSTRAAGYSSLLRILLTPPSPS
SPVSPLGGLSKVHVRASVQGRLYQRWYPAGPGLVHKLVWNKTDVYGQEVWGLTHTTVSVG
YEYESCPGVIHWERRTALMHGFELVPSNLGGWSLDKHHALNFRSGILHKGNGENIFLSQQ
PPVISTVMGNGFYRSVPCGPSCSGAARDMMLFAPVALASGPDGSLYIGDFNFIRRVHPDG
YTRTILELKNRDTRHSTSPAHKYYLAMDPVGEVLYVSDTSSRRVYRVRNLGQPKDPARNL
EVVAGTGEQCLPFDQSHCGEGRKATEAALNNPRGIAVDKRGVVYFVDGTTIQKINERGLL
STVIGSNGLMSTQPLSCDARMDISQVRLEWPTDLAINPLDNSLYILDNNIVLQVSESLQV
RIVAGRPIHCQVPGIDHHLVSRAAVRATLEAAKAIALSHLGTLFIAETDERRINRIQQVV
STNGEISIISGAPTDCDCKIDPNCDCFSGDGGYARDARLKAPSSLAVAPNGTLYIADLGN
IRIRAVNPNQPQPGPAGLVEISSPQDQELYLFSQNGSHMYTKHLITGHYLYNFSYGTDGQ
LSGLTSRDGRGLQVRRDAHGVPLWLALPGGQVYWLSLSNSGMLRKVSAQGHDLAHISYHG
NTGLLSTKSDENSWTTVYEYSSEGRVTNITLPTGEVSGFHGNLERWSRVEVEASNRENFV
TSTNLSASDTIYTFKQDHAQNSYRVSSDGSFLVALASGMELSLSTEPLLPGGAGGGVSPT
ASRCNISLPGDHGPSLIEWRQRKEQSKANYSTYERRLRAHNRNLLSIDFDQNTRVGKIYD
DHRKFTLHIQYDPLGRPVVWSPSSKYTEVNISYSAGGLLSAIHRGEWSERLEYENDRVVS
RAWVNGKIWSYTYADRSIMLLLHSQRRYIFDYDQTDRLVAVTMPSMVKHALQSLLSVGYY
RNIYTPPESQASFMQDYTLDGRLRRTQYLGTGRSVIYRYTPAARLSEVVYDSTLVTFTYD
EASGTVKTIHLTHDGFISSIRYRQTGPLTSRQIFRFSEEGLVNARFDYSYNNFRVTSMQA
VINETPLPIDLYRYVDVSGRVEQFGKFSVIFYDLNQVITTHLMKHTKVFNSYGQVVEVQY
EILKSIAYWMTIQYDSAGRITTCDIRVGVDSNVTRYTYEYDADSQLQSASVNERPQWRYG
YDLNGNINLLSHGTSSRLHKSFTVLNLCLPHCSTDNGKRQCLYKSQLEGYGEVYQDSNPD
FQLTIGFHGGLYDPFTRLVHLGRRDYDTLAGRWTSPNHELWGELSREPKPFNLYAFNSNC
PVGKVEEVTQFTTDIGRWLQLFGFQLHNVVPGFPKPEVSRMEQTYELMKTQTKTQDWDSS
KMVLGIQCELRRQLRSFISLERLPLVSEPVGSACHRPSHPPPFGSRPFILGPNIRFAVSH
GRVSAEVIGVASEDSRRVAAILNSAVHLTGLSFTVHGCDTHHFLQSRPIEEDLALGLGVG
GRILESGVNVSVSQMSATVNGRTRRFADITLQQGPLCLCVRYGGTEEEERARVKEEARKR
AVEGAWEKERKRLDLGDVGSRSWSEAEKQQLLSGGRVQGYDGYYSLPIEQQPELSDCPAN
IHFMTLSEVGGR
Download sequence
Identical sequences M4AC74
ENSXMAP00000012068 ENSXMAP00000012068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]