SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012186 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012186
Domain Number 1 Region: 2-122,155-196
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.58e-37
Family G proteins 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012186   Gene: ENSXMAG00000012168   Transcript: ENSXMAT00000012202
Sequence length 230
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556683.1:2930248:2935531:1 gene:ENSXMAG00000012168 transcript:ENSXMAT00000012202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKPDVKLVFLGDMNVGKTSLLHRYMERKFKDTISTVGGAFFLKQWGPYNISIWDTAGRE
QFHGLGSMYCRGAAAVILTYDVTNWQSLAELEERFLSLTDTANHDCIYALVGNKADLTDS
KAHHCQDSDRLPEDRGLLLHKQVAREDAVALYGRILRYKGLDEKSSLPADKMCFETSAKT
GYNVDVLFETLFDMVVPAILSKRHENQASPTVDLEDWRKVSGKRGKSSCC
Download sequence
Identical sequences M4ACJ2
ENSXMAP00000012186 ENSXMAP00000012186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]