SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012313 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012313
Domain Number 1 Region: 311-486
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.71e-45
Family CRAL/TRIO domain 0.0000371
Further Details:      
 
Domain Number 2 Region: 224-305
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 4.71e-20
Family CRAL/TRIO N-terminal domain 0.0014
Further Details:      
 
Domain Number 3 Region: 513-625,652-677
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 5.62e-18
Family Supernatant protein factor (SPF), C-terminal domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012313   Gene: ENSXMAG00000012280   Transcript: ENSXMAT00000012329
Sequence length 704
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556840.1:792853:805158:-1 gene:ENSXMAG00000012280 transcript:ENSXMAT00000012329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTAMVQQYQSPVRVYKQPFELIMAAYARRFPKCPLIPMFVDSENLSQSESKDGSVVVTER
RCTIDVEAPRLLKRIAGVEYLYFIQKNTLNRRDRTLHIEVHNETFSSRVIVRECCSYTVH
PENEDWTCFEQTASLDIKSFFGFESTAEKIAMKQYASSIKKGKEIIEYHLKELEEEGITR
MPRWMPMVDRGLLSSGKSVPVCGTTVGLPGKDLANPTELMTSSNDDKLDADYIRRYLGDL
TPLQESCLIRLRQWLQETHKGKIPKDQHVLRFLKARDFNMDKAREFLCQSLTWRKQHQVD
FLLDTWERPQLLQDYYTGGWHHHDRDGRPLYVLRLGQMDTKGLVRALGEEVLLRQVLSIN
EEGLKRCEENTRVFGRPISCWTCLVDLEGLNMRHLWRPGVKALLRMIEVVEANYPETLGR
LLILRAPRVFPVLWTLVSPLIDENTRKKFLVYAGRDYQGPGGLVDYIDREIIPDFLGGDC
LCDIPEGSAVPKSLYRTAEQLENEENCLLTDSIYKSASIFKGAPYEVLIEITEASSVITW
DFDVCKGDVLFNIYHSKRAPQPQKKDSLGAHGIASLGAVNAQLIDKNWVLGKDYSMVEKA
LTCREGESVQGSHVTRWPGFYILQWRFHSSAASAASSLARVDDVLATLQVSSHKCKIMYY
TEVLGSHDFRGSMTSLESCQSGFSQLSAATTSSNRSCASSTVSR
Download sequence
Identical sequences M4ACW9
ENSXMAP00000012313 ENSXMAP00000012313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]