SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012579 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012579
Domain Number 1 Region: 13-138
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.62e-28
Family Hormone receptor domain 0.0015
Further Details:      
 
Domain Number 2 Region: 129-425
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000375
Family Rhodopsin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012579   Gene: ENSXMAG00000012523   Transcript: ENSXMAT00000012595
Sequence length 535
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556791.1:640184:656934:-1 gene:ENSXMAG00000012523 transcript:ENSXMAT00000012595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQVCLLLALLTLSSCTKVSFANSLELVKEKWSNYKDNCTSQINSTPPATGLVCNRTFDL
YACWPDGRPGTTVNVSCPTFLPWHQKVQRGLVYRVCNEDGKWGQKNTSECEDDPGESGLQ
QQYGRILSKLRIMYTVGYSLSLGALLLALAILISFRKLHCMRNNIHMNLFASFILRAVSI
LIKDALLSPMLDPKSGSDAQTQAWVNIPAVMWCRGAMVMMQYSVIANNYWLLVEGIYLHS
LLVITVFSEKKYFYIYLAIGWGAPLIFVLPWITVKYLYENIECWERNINMGYWWIIRSPI
LFAYLINFFIFIRIIKILMSKLRAHQMRYTDYKFRLAKSTLTLIPLLGIHAILFTFVIDE
SVPKGSMLRLIRLFCDLLFNSFQGLLVAILYCFVNKEVQSEMLKKWKRWKLGKDIDEEYR
HTHSQTPHVKSGSIATGNLTDLQDNNASDPSNDSPRSNKANCHPSCSAEENRRLVVSYSN
GTGKARSAKNRQALQFTFPPQRGATSRGSSTTEDISLEDRAQHRSYPQEGDETSV
Download sequence
Identical sequences M4ADN5
ENSXMAP00000012579 XP_014326511.1.87360 ENSXMAP00000012579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]