SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012615 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012615
Domain Number 1 Region: 168-311,365-397
Classification Level Classification E-value
Superfamily YWTD domain 0.00000188
Family YWTD domain 0.04
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000012615
Domain Number - Region: 18-96
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00162
Family HBL-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012615   Gene: ENSXMAG00000012596   Transcript: ENSXMAT00000012631
Sequence length 401
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556691.1:2279100:2289508:1 gene:ENSXMAG00000012596 transcript:ENSXMAT00000012631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLFVLLVSCAWTLIGAQNYYQALMDYLENRLLAIEDRMQLWHEQAHQYRTEMLDFKKL
TSEAMTGIKNDHSMMFKDLKGASARVDLVEREMDYVETQNSPRACATKAEKVLEQEAWGL
QERDEVEEEEDWEELQSRVSDCMEIISGIRSVKILKRIGSPKGMWTRDPKSSKLYVFNGT
SGDTVYEFQSVLDFSRSLGVAGSRMIHLPSKWTGPGSAVYNGYLYYINQETDTDVQVVKF
DLVSGSVTEIAMFPMERNTIVYTLNPETVADLAVDDEGLWLLFTPTDSEPNISLAKMDTS
TLDIEQIWDTRCPRGNAEAAFVVCGTVYVVYNTRMASRSRVQCVFDVNDMMLTEEAPLLY
FPRRYGAHASLKYNPEENQLYGWDDGYQIIYRLTIKTKLLA
Download sequence
Identical sequences M4ADS1
ENSXMAP00000012615 XP_005799032.1.87360 ENSXMAP00000012615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]