SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012669 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012669
Domain Number 1 Region: 388-681
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.09e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000029
Further Details:      
 
Domain Number 2 Region: 77-238
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.57e-33
Family CRAL/TRIO domain 0.00061
Further Details:      
 
Domain Number 3 Region: 5-73
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000144
Family CRAL/TRIO N-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012669   Gene: ENSXMAG00000012626   Transcript: ENSXMAT00000012685
Sequence length 700
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556790.1:1147414:1161266:1 gene:ENSXMAG00000012626 transcript:ENSXMAT00000012685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEALTTQEQLAVEEFLREVRSREHPHSAGLVSQPTAVKFLMARKFDVSRAIDLFQAYKN
TRIKEGIININPDEEPLRSELLSGKFTVLPGRDANGAALALFTARLHRPDITTHKAVLQA
IIYQLDKAIESLETQKDGLIFIYDMTNSSYGNFDYELCVKILNLLKGAFPARLKCVFIVS
SPLWFRAPFAVLRLFVREKLRERVSTVRAHELVSHIPVSSLPEHLGGTSQYSHVAWIQSC
VNMQSNTAQGDTQEHDTHDCVGSLLRSYSLDNSNASIGTVPSHTLQGTERAVANANCYDD
NNANPQNHIVGVGNHQHWNGTALGGANTGVGPNSNMNGRAPTQSDTPPNTPLSQKADDDP
AVPPLPQKALPRPPNQEVSVHMPDQGGMTVHQLVEYVKRKKKKGIYQEYEDIRKEPPAGT
FDYSKKMSNQIKNRYSDVLCLDQSRVRLCQLCDDEDETSDYINASFMDGYKRSNAYIATQ
GPLPKTFVDFWRMVWEQMVLIIVMTTRVVERGRVKCGQYWPLEEGRTEQHGYFMVKNTHI
QVFQDFKLSYLELYNTQSGEKREVCHYLYVSWPDFGVPKSASAMLDFREHVLERRKAAVQ
SLGSSWRGPPGGPPVVVHCSAGIGRTGTFCTLDICLSQLEDVGTVNVHQTVRRMRTQRAF
SIQTWDQYYFCYTAVIEYAQRHGRLSPVQWSDSELETDSE
Download sequence
Identical sequences M4ADX5
ENSXMAP00000012669 ENSXMAP00000012669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]