SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000013017 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000013017
Domain Number 1 Region: 12-132
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.96e-29
Family Hormone receptor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 105-429
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000192
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000013017   Gene: ENSXMAG00000012984   Transcript: ENSXMAT00000013033
Sequence length 518
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556724.1:1626995:1670646:-1 gene:ENSXMAG00000012984 transcript:ENSXMAT00000013033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLFLFLAVLIVSCSIQMSPAATLDKLKDDWKRYRTECEYNNSQYPPSSGLVCNRTFDD
YACWPDGFPNTTVSVECPWYLPWYHKVQHGMVYQDCDANGQWVTKYNTTECEIHSTNQIY
YRCIWIMYTVGYSLSLVALVLALGILIFFRKLHCMRNNIHMNLFASFILRALSVLIKDAL
LEANFTSQKISGDRDQGFPSESIPPVELLTTVSCRTAVVMMQYSIMANSYWLLVEGIYLH
NLLVITVFTERNYFKIYLCIGWGTPLIFLVPWAVSKYLYENKECWEQNTDMNIWWIIRAP
ILLGVVINFIIFIHIIKILVSKLRAHQMRYTDYKVRLAKSTLTLIPLLGIHQIVFIFLPE
ETTNKSLHLRLTKLFIDLFFSSFQGLLVAILYCFVNKEVQSEILKKWKRWKLGRNIEEEY
RHTYSNSNNTKTASLLNHIPRLPHLPDIAKSSGPVCRPEEQTWLVACCHNGMVHGKETEN
SSSQQNEGTSNCTLVEDINQSGKMQCYEVQRENVESHL
Download sequence
Identical sequences M4AEX3
ENSXMAP00000013017 ENSXMAP00000013017 XP_014325175.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]