SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000013350 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000013350
Domain Number 1 Region: 8-335
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.05e-56
Family Rhodopsin-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000013350   Gene: ENSXMAG00000013323   Transcript: ENSXMAT00000013366
Sequence length 358
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556719.1:837077:845510:-1 gene:ENSXMAG00000013323 transcript:ENSXMAT00000013366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSTPASDSSSSCCNSSHLLFHPSLFPVPTFSGFDLLFSLKLLFIPLYSVVVLIACSGNLL
LLFLIWYNKKRHNTTNFLISNLALVDLVMCVFCVPLTASYAFDRRGWVFGYHMCHFVTVM
QSTTVYAAVLSLMAIAVDRYIVVAYPIRKRAGCQFCCFLVMLIWLSSLALSTPTALHTVY
LDLHTAGLDMAICEEFWDGQEQGRLIYSCFILFFSYFVPLAAVSISYCAISCHLKRRTTS
SLTACPELRCARAAWSRRRWKTFCLLLVSVLCFAFSWLPLQVVNLIRDLDTDFSILGKNY
INVIQVSAHLLAMSSACYNPFIYASLHNKFLSYLCLNPLTRRRGTEKHGVSLSCILVF
Download sequence
Identical sequences M4AFV6
ENSXMAP00000013350 ENSXMAP00000013350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]