SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000013395 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000013395
Domain Number 1 Region: 13-313
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.74e-35
Family Rhodopsin-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000013395   Gene: ENSXMAG00000013358   Transcript: ENSXMAT00000013411
Sequence length 314
Comment pep:novel scaffold:Xipmac4.4.2:JH558613.1:3977:9227:-1 gene:ENSXMAG00000013358 transcript:ENSXMAT00000013411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDHLNSSFTNLGAYVDVGRWRYLCFLITAVLYLIIVACISTSTLIQHVVFVFIQLLGPVR
VLIIFMNLLINKLILSIWTRSEFLVQILSDVHSVSVPLCFLQIFCLYMYANVEFYTLAVM
SYDRYLAICHPLHYSTQMQMSKVSRLVVFSWFIPLLNIIVMISLNASSGLCGNIIDKVFC
VNYYVTKLLCSGATASNVYGLVYTCSVLPSLAALILYTYVKILKVCFSGSKQTRQKAIST
CMPHLASVLNFFFCSFFEILQSRFDLSRLPAVLRIVLSLYFVTCQPFFNPLVYGLKLGKI
RLACKALFFHRRKP
Download sequence
Identical sequences M4AG01
ENSXMAP00000013395 ENSXMAP00000013395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]