SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014350 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014350
Domain Number 1 Region: 730-1008
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000174
Family Rhodopsin-like 0.023
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000014350
Domain Number - Region: 388-448
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000863
Family Hormone receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014350   Gene: ENSXMAG00000014328   Transcript: ENSXMAT00000014370
Sequence length 1019
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557642.1:44706:60861:1 gene:ENSXMAG00000014328 transcript:ENSXMAT00000014370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTKHFLFLVGALCMCQVFSQDIYVAEVMVESNVTLTSESILASWSPSVSLSVGGNNVLI
SSSELVAECLVVGEEYSCNCSTGYAWSNEVCYNYGCCTEAPCLKNVSQATFICVEKFNVI
INGSVQLTSGSWASAQTTKLETGLRMLNGVGSVNITGPRPLESTTADFQMNVYVRLDLTN
LQQILNGLTVNLSSAPIYVDTKQMVNISVVSDTVKYKESIGLTCVMEEATVSAGWNLSRP
FERFSINKGLLTQITKDCATAEYLSCVKLVVTEATGAWTGTYECGFTTGTIRHTASIPIK
VVLLPDVITMKFSPLIADCSGKNPSITVTATIPKSEEAYKYYWNYNGNNEPEHNANNLTS
FNYPCQLDCAYKGPQVVKITFKNNLGQEATAAVEIPVFRETAIFCKKETLNNELWPKTPG
GVTLTNQTCPPGRVGFKSRTCDQEGIWQEVFSKCISEELSKVTDAANKFRDGLGATQEVA
KNIFEGVKNSSSLSSDGSGGDVADIGASIGIIGVMANASANIALDENLFPDLIDAASNMV
NSNWSGVNNTVRHGMSANYLSNVETLVKNIKINTSEGFNSTNLELKFCSSDDCSISVYGI
DVNLNKTNGTMKTMGVKNLMEKLENKNFPGRNHSSILLSTTLEGNNDSDIKITMFFPDEQ
PTAIERLCVFWDTNAKDWSSEGCIANITDDNQTLCECNHLTSFSVLMSKGVNPNTKDSLI
LDTITNIGLGVSIFSLLIFLFVESLVWSAVTKTNLSHFRHTAVVNIAVFRLLADCSFLAS
TDPKKLSDTWCFTFTVCKHLFYLTMFCWMLCLSVMLVHQLIFVFSPVRKRVFMYLSSIVG
YVVPIALVGTSYVYYKYKEQDYYSRDTCWLTYVRLLEGSIHAFLLPVGTIILSNVFSMVV
VIVTLVKTSVPDSSKSDDKDTAKSILKVIVFLAPVFGVTWIIGFAILLLDQTNSLHGVAE
YAFVILNSFQGLLILLTGCVGEQKVRQEVVRIIMVKTGRDTDSTKKLTNSSTTLYTKEK
Download sequence
Identical sequences M4AIQ6
ENSXMAP00000014350 ENSXMAP00000014350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]