SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014898 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014898
Domain Number 1 Region: 135-254
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.24e-23
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.005
Further Details:      
 
Domain Number 2 Region: 236-323
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 7.06e-18
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000014898
Domain Number - Region: 524-611
Classification Level Classification E-value
Superfamily EF-hand 0.00748
Family p25-alpha 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014898   Gene: ENSXMAG00000014874   Transcript: ENSXMAT00000014918
Sequence length 752
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557054.1:341334:350404:-1 gene:ENSXMAG00000014874 transcript:ENSXMAT00000014918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLNELCDEEICMEAEIENNESGGENLDESLLSLSERVANILLRGSESNDRTQTEDIYD
LPDIICLKIQRYKGETSDGQINGEGVASFHGGHEYKGIFSKGLMEGFGTFTQADGVKYEG
DFVCNLPMGQGTFTWLDGSTYTGDISRGIRHGRGTYKCPRTGMSYSGQWDHSKRHGKGKV
YYDEDQTSWYDGDWVVNKRDGWGERGYPSGNTYTGEWRNNLRHGEGTMNWTKLRQQYVGS
WKDGVQHGLGTHTWFLKRIDGSQYAQSNQYSGEFFEGQRHGKGIFYYAGGAIYTGEWRNN
KKHGQGKLTARSGRVFECDFDDDLILASLNEDRASLPLGILPLSDNDSKILGSDMAFNIQ
VLLNKIPQRDRETERMKVESVVMSQHVELRLIFGFYSKLGLSSRSSPPDNIFLLSHLQFW
RLLKDCNIHRHSVTLTQIERLIREDRGVAKTCSPFTFMPLHEFLMGLVTVAYYIYREDLV
SEKHLLAACFSKLMTNDVLPNARNVKGLLFSQPDVTQEALKYLSKCWEIFQYFCRIYSAH
SDETSMTCRHLLRMFKDLGLFDQRLTTTTLLEFLIAEHCLSDNWPSRVDLEIVFLEFFEV
LLGCAELKFQQVFDEPEESTVQIVTDSQTTEAEEASGEEEAEATAEHVQEEENDPVPKME
SEEDEPEEPEEPQPADFLEDHSKEKMSEHESRDHQEPSTIQQFFTHCFFPAVEHHVLVTR
KMEKLAEAVQNTKEPEAIISLYEDEEPESEDT
Download sequence
Identical sequences M4AKA4
ENSXMAP00000014898 ENSXMAP00000014898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]